DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and GluRIID

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_651982.1 Gene:GluRIID FlyBaseID:FBgn0028422 Length:902 Species:Drosophila melanogaster

Alignment Length:930 Identity:301/931 (32%)
Similarity:485/931 (52%) Gaps:106/931 (11%)


Mouse    14 GAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALS----QLTEPPKLLPQIDIVNISDSFEMTYRF 74
            |....|:...:|::|.:..:...:....|..|:|    :|..|  |:.:.:.|...:|.:...:.
  Fly    23 GNAYEASSGQSIRLGLITDDATDRIRQTFEHAISVVNNELGVP--LVGETEQVAYGNSVQAFAQL 85

Mouse    75 CSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTS-NQFVLQLRPE-LQEALISII 137
            |.....||.|:||...|.|.:.|.:.|.:..:.||.|.....:: :.|.|...|| :..||..|:
  Fly    86 CRLMQSGVGAVFGPAARHTASHLLNACDSKDIPFIYPHLSWGSNPDGFNLHPSPEDIANALYDIV 150

Mouse   138 DHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVV 202
            :.::|..|::.|::...|.:|..::.....|...:..:.........|:.:.:.:.|.::..:||
  Fly   151 NQFEWSRFIFCYESAEYLKILDHLMTRYGIKGPVIKVMRYDLNLNGNYKSVLRRIRKSEDSRIVV 215

Mouse   203 DCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIM 267
            ...:..:..:|.|..::......|.||:.||.....||.::|.|.||:||.::.:     |.:  
  Fly   216 VGSTTGVAELLRQAQQVGIMNEDYTYIIGNLNLHTFDLEEYKYSEANITGIRMFS-----PDQ-- 273

Mouse   268 QQWRTSDARD-----HTRVDWKRPKYTS--------ALTYDGVKVMAEAFQSL--RRQRIDISRR 317
                 .:.||     |..:....|..:.        |||||.|:|:||..:.|  :.|.::.|.|
  Fly   274 -----EEVRDLMEKLHQELGESEPVNSGSTFITMEMALTYDAVRVIAETTKHLPYQPQMLNCSER 333

Mouse   318 GN----AGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRK 378
            .:    .|....|          ..|:| :::.:.:||.:.| |...|..:|..|||::..|:.|
  Fly   334 HDNVQPDGSTFRN----------YMRSL-EIKEKTITGRIYF-EGNVRKGFTFDVIELQTSGLVK 386

Mouse   379 IGYWNEDDKF----VPAATDAQAGGDNSSVQNRTYIV-TTILEDPYVMLKKNANQFEGNDRYEGY 438
            :|.|.|...|    .|.|.:.. ..|:.|:.|:|:|| .::...||..|.::.:...||::::||
  Fly   387 VGTWEEGKDFEFQRPPQAVNFN-DIDDGSLVNKTFIVLISVATKPYASLVESIDTLIGNNQFQGY 450

Mouse   439 CVELAAEIAKHVGYSYRLEIVSDG--KYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREE 501
            .|:|..|:|..:|:::...   ||  .||:.:..|.:.:||:.|:|.||||:|:..||||..|||
  Fly   451 GVDLIKELADKLGFNFTFR---DGGNDYGSFNKTTNSTSGMLKEIVEGRADLAITDLTITSEREE 512

Mouse   502 VIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWH 566
            |||||.|||:|||:|:..||||:.|.:|||:||.:.|:|:.:..||:|||:..|::.|.||.||.
  Fly   513 VIDFSIPFMNLGIAILYVKPQKAPPALFSFMDPFSSEVWLYLGIAYLGVSLCFFIIGRLSPIEWD 577

Mouse   567 S-----EEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLII 626
            :     ||.||        ..|:|.|.|||||:.||.:|||.:|:|::||.|.:..:|||||||:
  Fly   578 NPYPCIEEPEE--------LENQFTINNSLWFTTGALLQQGSEIAPKALSTRTISAIWWFFTLIM 634

Mouse   627 ISSYTANLAAFLTVERMVSPIESAEDLA-KQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKS 690
            :||||||||||||:|...|||.|.:||| .:.::.||....|||:.||..|:..::.||..|: :
  Fly   635 VSSYTANLAAFLTIENPTSPINSVKDLADNKDDVQYGAKRTGSTRNFFSTSEEPIYIKMNEYL-N 698

Mouse   691 AEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSA 755
            |.|.:.:...::|:.:| ||..|||:|:|||..|:...|: |:..|||..||.||||||..|...
  Fly   699 AHPEMLMENNQQGVDKV-KSGTKYAFLMESTSIEFNTVRE-CNLTKVGDPLDEKGYGIAMVKNWP 761

Mouse   756 LRGPVNLAVLKLSEQGVLDKLKSKWWYD--KGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLG 818
            .|...|.|:|:|.|||||.:||:|||.:  .|.|.:|  ...|..|.|.:.|::|::.:|:.|..
  Fly   762 YRDKFNKALLELQEQGVLARLKNKWWNEVGAGVCSAK--SDDDGPSELGVDNLSGIYVVLVIGSI 824

Mouse   819 LAMLVALIEFCYKSRSESKRMK-GFCLIPQQSINEAIRTSTLPRNSGAGASGGSGSGENGRVVSQ 882
            ::::::::.:||....::|..: .||....:.....||.|                 ||.|.:  
  Fly   825 ISIIISILCWCYFVYKKAKNYEVPFCDALAEEFRIVIRFS-----------------ENERPL-- 870

Mouse   883 DFPKSMQSIPCMSHSSGMPL 902
               ||.|||...|.:|...:
  Fly   871 ---KSAQSIYSRSRNSSQSI 887

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 91/392 (23%)
ANF_receptor 37..372 CDD:279440 84/360 (23%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 176/392 (45%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 126/287 (44%)
Glutamate binding. {ECO:0000250} 668..669 1/1 (100%)
PDZ-binding 904..907
GluRIIDNP_651982.1 PBP1_iGluR_Kainate 35..397 CDD:107377 91/388 (23%)
ANF_receptor 46..380 CDD:279440 84/360 (23%)
PBP2_iGluR_Kainate 417..788 CDD:270432 175/385 (45%)
Lig_chan 549..819 CDD:278489 124/283 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111018316
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.