DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and CG11155

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_651941.2 Gene:CG11155 FlyBaseID:FBgn0039927 Length:910 Species:Drosophila melanogaster

Alignment Length:841 Identity:335/842 (40%)
Similarity:485/842 (58%) Gaps:52/842 (6%)


Mouse    16 VVGANFPNNIQIGGLF--PNQQSQEHAAFRFALSQLTEPPKLLP------QIDIVNISDSFEMTY 72
            |:....|..|::|.:|  ..::|...:||::|:.::.:...|||      .|:.|...|||..|.
  Fly    34 VISNALPPVIRVGAIFTEDERESSIESAFKYAIYRINKEKTLLPNTQLVYDIEYVPRDDSFRTTK 98

Mouse    73 RFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVD-TSNQFVLQLRPE---LQEAL 133
            :.|||...||.||||..:....:.:.|.|.|..:..|.....:: .|.:|.:.|.|.   |..|.
  Fly    99 KVCSQLEAGVQAIFGPTDALLASHVQSICEAYDIPHIEGRIDLEYNSKEFSINLYPSHTLLTLAY 163

Mouse   134 ISIIDHYKWQTFVYIYDADRGL-SVLQRVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKE 197
            ..|:.:..|.....||:.|.|| :::....:|.||       :.|...:.:.||.:.:.:.:|:.
  Fly   164 RDIMVYLNWTKVAIIYEEDYGLFNLMHSSTETKAE-------MYIRQASPDSYRQVLRAIRQKEI 221

Mouse   198 RLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTI 262
            ..::||.....:.:....|::|:.|...|||:.........||..|:.:..|:|.|:||   |..
  Fly   222 YKIIVDTNPSHIKSFFRSILQLQMNDHRYHYMFTTFDLETYDLEDFRYNSVNITAFRLV---DVD 283

Mouse   263 PARIMQQWRTSDARDHTRVDWKRP----KYTSALTYDGVKVMAEAFQSL---RRQRIDISRRGNA 320
            ..|.::.........|..:|....    :..|||.:|.|...|.....|   ..|...|......
  Fly   284 SKRYLEVINQMQKLQHNGLDTINGSPYIQTESALMFDSVYAFANGLHFLNLDNHQNFYIKNLSCT 348

Mouse   321 GDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNED 385
            .|      ..|..||.:...:.....:||||.|||.| |||..:.|.::::|.:.|:|:|||:.|
  Fly   349 SD------QTWNDGISLYNQINAAITDGLTGTVQFVE-GRRNIFKLDILKLKQEKIQKVGYWHPD 406

Mouse   386 DKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHV 450
            |..  ..:|..|..| |::.|.|.:|.|..|.||||:|::.| ..||.|:||:|::|...||..|
  Fly   407 DGV--NISDPTAFYD-SNIANITLVVMTREERPYVMVKEDKN-LTGNLRFEGFCIDLLKAIATQV 467

Mouse   451 GYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGIS 515
            |:.|::|:|.|..||...|:|.:|||:|.||:..|||:|||.:||...||.||||:||||:|||.
  Fly   468 GFQYKIELVPDNMYGVYIPETNSWNGIVQELMERRADLAVASMTINYARESVIDFTKPFMNLGIG 532

Mouse   516 IMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEE--FEEGRDQTT 578
            |:.|.|......:|||::|||.|||:.::.|||.||..||:::|||||||.:..  ::|     |
  Fly   533 ILFKVPTSQPTRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKE-----T 592

Mouse   579 SDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERM 643
            ....|:|.|.||.||..|.|::||..::|::.|.|||||.|:||.||||||||||||||||||||
  Fly   593 DIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTVERM 657

Mouse   644 VSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVR 708
            :||||||.|||:||||:|||||.|||..|||.|||.:::|||.||::.:.:|||:|.|:|:.|| 
  Fly   658 ISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRV- 721

Mouse   709 KSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVL 773
             .:|.||:|:||||.:|..|| .|:..::||.||||||||||||||..|..::||:|:|.|:|::
  Fly   722 -MEGSYAFLMESTMLDYAVQR-DCNLTQIGGLLDSKGYGIATPKGSPWRDKISLAILELQEKGII 784

Mouse   774 DKLKSKWWYDKGE-CGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSR 833
            ..|..|||.:.|: |...|...:.|.:||.:.|:.|||.:|:.||.||::||:.|||:.||
  Fly   785 QILYDKWWKNTGDVCNRDDKSKESKANALGVENIGGVFVVLLCGLALAVVVAIFEFCWNSR 845

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 101/383 (26%)
ANF_receptor 37..372 CDD:279440 90/353 (25%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 206/384 (54%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 151/282 (54%)
Glutamate binding. {ECO:0000250} 668..669 1/1 (100%)
PDZ-binding 904..907
CG11155NP_651941.2 PBP1_iGluR_Kainate 44..410 CDD:107377 101/385 (26%)
ANF_receptor 61..393 CDD:279440 90/349 (26%)
PBP2_iGluR_Kainate 424..793 CDD:270432 205/378 (54%)
Lig_chan 555..829 CDD:278489 151/282 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110989546
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.