DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ekar

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001036250.1 Gene:Ekar FlyBaseID:FBgn0039916 Length:899 Species:Drosophila melanogaster

Alignment Length:886 Identity:320/887 (36%)
Similarity:488/887 (55%) Gaps:84/887 (9%)


Mouse    18 GANFPNNIQIGGLFPNQQSQEHA--AFRFALSQLTEPPKLLPQ------IDIVNISDSFEMTYRF 74
            |...|..::||.:|.||....::  |||:|:.:|.....|||:      ::.||..||||...:.
  Fly    16 GLGVPPLVRIGAIFSNQPGMYNSELAFRYAIHRLNMDKSLLPETTVDYYVEYVNRFDSFETVQKV 80

Mouse    75 CSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQ---EALISI 136
            |.....||.|:|...:......:.|.|.||.:..|..|     ::.|.:.:.|..|   .|...:
  Fly    81 CKLIRVGVQAVFSPTDSVLATHINSICDALDIPNIGRS-----AHDFSINVYPSKQLVNYAFNDV 140

Mouse   137 IDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVV 201
            |.:..|..|..:::.:.|:..|.::..:...:      |::...:.:.|.....:.:.|:...::
  Fly   141 IQYLNWTRFGILHEKENGIINLHQLSRSFHGE------VHMRQVSRDSYVSALNEFKGKEIHNII 199

Mouse   202 VDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARI 266
            :|..|..::.:|..|::.:.|...|||:..:......||..||.:..|:|.|:||:..|....:|
  Fly   200 IDTNSNGISILLKNILQQQMNEYKYHYLFTSFDLETYDLEDFKYNFVNITSFRLVDTADVGVKQI 264

Mouse   267 MQQWRTSDARDHTRVDWKRP-------KYT-----SALTYDGVKVMAEAFQSLRRQR----IDIS 315
            ::     |...::...:|:|       |.|     .||.:|.|.|.|...|:|.:..    ::||
  Fly   265 LK-----DIGLYSHHIFKKPYLNLHIKKSTILESEPALMFDSVYVFAIGLQTLEQSHSLTLLNIS 324

Mouse   316 RRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIG 380
                   |....:  |..|:.:...|..|.::||||.:||.: |:|..:.|.:|::|...|.|:|
  Fly   325 -------CEEENS--WDGGLSLINYLNAVEWKGLTGPIQFKD-GQRVQFKLDLIKLKQHSIVKVG 379

Mouse   381 YW--------NEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEG 437
            .|        .|...|..|.:           .|.|.:|.||||.||||:....| |.||:|:.|
  Fly   380 EWTPHGHLNITEPSMFFDAGS-----------MNVTLVVITILETPYVMMHYGKN-FTGNERFYG 432

Mouse   438 YCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEV 502
            :||::...|::.||:.|.|::|.|.||||:||:|..|||||.:|:..:||:||..:|||..||.|
  Fly   433 FCVDILETISREVGFDYILDLVPDRKYGAKDPETGEWNGMVAQLMKYKADLAVGSMTITYARESV 497

Mouse   503 IDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHS 567
            |||:||||:|||||:.|.|......:|||::|||.|||:.::.||..||:.:::|.:.||.||  
  Fly   498 IDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEW-- 560

Mouse   568 EEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTA 632
             :.....|.......|:|.:.:|.||::|.||||..||.||::|.||:...|.||:|||::||||
  Fly   561 -KCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTA 624

Mouse   633 NLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFV 697
            |||||||.|||::|||:|||||.||||:||||::|||..|||.|.|..::|:|..|.:.:||.|.
  Fly   625 NLAAFLTTERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFT 689

Mouse   698 RTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNL 762
            .|.|:|:.||  ::|.||:|:||||.:||.|| .|:..::||.||:|||||||||||..|..::|
  Fly   690 TTYEDGIKRV--NQGNYAFLMESTMLDYIVQR-DCNLTQIGGLLDTKGYGIATPKGSPWRDKISL 751

Mouse   763 AVLKLSEQGVLDKLKSKWWYDKGE-CGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALI 826
            |:|:|.|:|.:..|..|||.:..| |..|::..:.|.::|.|.::.|||.:||.|:.:|.:||..
  Fly   752 AILELQERGDIQMLYDKWWKNTDETCTRKNTSKQSKANSLGLESIGGVFVVLIAGIIVAAVVAFF 816

Mouse   827 EFCYKSRSESKRMKGFCLI----PQQSINEAIRTSTLPRNS 863
            ||.|..|...:......::    .|..|.|:.|..|.|..|
  Fly   817 EFWYNFRYNYEATPSQSVVNNKYNQDGILESERNYTPPDRS 857

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 98/398 (25%)
ANF_receptor 37..372 CDD:279440 86/362 (24%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 194/382 (51%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 136/280 (49%)
Glutamate binding. {ECO:0000250} 668..669 1/1 (100%)
PDZ-binding 904..907
EkarNP_001036250.1 PBP1_iGluR_Kainate 24..388 CDD:107377 96/390 (25%)
ANF_receptor 39..371 CDD:279440 86/358 (24%)
PBP2_iGluR_Kainate 402..771 CDD:270432 193/376 (51%)
Lig_chan 533..807 CDD:278489 136/280 (49%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110989576
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.