DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Grik

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001262788.1 Gene:Grik FlyBaseID:FBgn0038840 Length:907 Species:Drosophila melanogaster

Alignment Length:937 Identity:301/938 (32%)
Similarity:477/938 (51%) Gaps:107/938 (11%)


Mouse     6 AFFCTGFLGAVVGANFP----NNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNIS- 65
            |.|..||:...:...||    ....:|.::.|........|..|:|:..|..:.| |:..|::| 
  Fly    11 ASFPLGFILTSLLLAFPGCRGERTNVGLVYENTDPDLEKIFHLAISKANEENEDL-QLHGVSVSI 74

Mouse    66 ---DSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQF-----V 122
               :|||.:.:.|....:.:.|:||...........|.|.|..:.|:      ||...|     .
  Fly    75 EPGNSFETSKKLCKMLRQNLVAVFGPTSNLAARHAMSICDAKELPFL------DTRWDFGAQLPT 133

Mouse   123 LQLRPE---LQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEEG 184
            :.|.|.   |..||..::....|::|..||::...|..::.:|.........||...........
  Fly   134 INLHPHPATLGVALRDMVVALGWESFTIIYESGEYLPTVRELLQMYGTAGPTVTVRRYELDLNGN 198

Mouse   185 YRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGAN 249
            ||.:.:.:....:...||......|.....|..::......|.||:.||.:..:||..::.:|.|
  Fly   199 YRNVLRRIRNADDFSFVVVGSMATLPEFFKQAQQVGLVTSDYRYIIGNLDWHTMDLEPYQHAGTN 263

Mouse   250 VTGFQLVN-------------YTDTIPARIMQQWRTSDARDHTRVDWKRPKYTSALTYDGVKVMA 301
            :||.:||:             |....|.:.:....|:               :.||.||||:::|
  Fly   264 ITGLRLVSPDSEQVQEVAKALYESEEPFQNVSCPLTN---------------SMALVYDGVQLLA 313

Mouse   302 EAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTL 366
            |.::.:..:.:.:|         .|....|.:|..:...::.:...||||.::|:.:|.||::.|
  Fly   314 ETYKHVNFRPVALS---------CNDDSAWDKGYTLVNYMKSLTLNGLTGPIRFDYEGLRTDFKL 369

Mouse   367 HVIEMKHDGIRKIGYWNEDDKFV---PAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQ 428
            .|||:...|::|||.|:.:|.|.   ||...: ...|..|:.|::::|.|.:.:||.|||:.:.:
  Fly   370 EVIELAVSGMQKIGQWSGEDGFQENRPAPAHS-LEPDMRSLVNKSFVVITAISEPYGMLKETSEK 433

Mouse   429 FEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPL 493
            .||||::||:.:||..|::|.:|:||...:..|.|||..||.|..||||:.|::..|||:.:..|
  Fly   434 LEGNDQFEGFGIELIDELSKKLGFSYTWRLQEDNKYGGIDPKTGEWNGMLREIIDSRADMGITDL 498

Mouse   494 TITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVS 558
            |:|..||..:||:.|||||||.|:.:||.|..|.:|||:.|.:.|:|:.:..||:|||:.:|::.
  Fly   499 TMTSERESGVDFTIPFMSLGIGILFRKPMKEPPKLFSFMSPFSGEVWLWLGLAYMGVSISMFVLG 563

Mouse   559 RFSPYEWHSEE--FEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWF 621
            |.||.||.:..  .||     .::..|:|...|.||||:||.:|||.:::|::.|.|.|...|||
  Fly   564 RLSPAEWDNPYPCIEE-----PTELENQFSFANCLWFSIGALLQQGSELAPKAYSTRAVAASWWF 623

Mouse   622 FTLIIISSYTANLAAFLTVERMVSPIESAEDLAK-QTEIAYGTLEAGSTKEFFRRSKIAVFEKMW 685
            ||||::||||||||||||||.:|:||..|:||:| :..:.||....|:|..||:.|....:::|:
  Fly   624 FTLILVSSYTANLAAFLTVESLVTPINDADDLSKNKGGVNYGAKIGGATFNFFKESNYPTYQRMY 688

Mouse   686 TYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIAT 750
            .:|:. .|.....|.:||:.||..|  .||:|:|||..|||.:|: |...:||..||.||||||.
  Fly   689 EFMRD-NPQYMTNTNQEGVDRVENS--NYAFLMESTTIEYITERR-CTLTQVGALLDEKGYGIAM 749

Mouse   751 PKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDK---GEC--GSKDSGSKDKTSALSLSNVAGVF 810
            .|....|..::.|||::.|||:|.|:|:|||.:|   |.|  ..:|||:    .||.:||:.|||
  Fly   750 RKNWPYRDTLSQAVLEMQEQGLLTKMKTKWWQEKRGGGACSDADEDSGA----VALEISNLGGVF 810

Mouse   811 YILIGGLGLAMLVALIEFC--YKSRSESKR-------MKGFCLIPQQSIN-EAIRTSTLPRNSGA 865
            .::..|....:.|:|:|..  .|.||:..:       :.....|.|.|.| :|::   .|:||..
  Fly   811 LVMGVGSFFGIFVSLLEMVLGVKERSDENQVSFKTELLDEIRFILQCSGNTKAVK---YPKNSSR 872

Mouse   866 GASGGSGSGENGRVVSQDFPKSMQSIP 892
            ..:.....|.:         .|:.|:|
  Fly   873 SNASSKSKGSS---------MSVDSLP 890

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 90/388 (23%)
ANF_receptor 37..372 CDD:279440 81/360 (23%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 171/387 (44%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 124/287 (43%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
GrikNP_001262788.1 PBP1_iGluR_Kainate 37..391 CDD:107377 89/385 (23%)
ANF_receptor 53..374 CDD:279440 80/352 (23%)
Periplasmic_Binding_Protein_Type_2 411..781 CDD:304360 169/379 (45%)
Lig_chan 543..816 CDD:278489 123/286 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111018289
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.