DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and KaiR1D

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_650925.1 Gene:KaiR1D FlyBaseID:FBgn0038837 Length:853 Species:Drosophila melanogaster

Alignment Length:846 Identity:335/847 (40%)
Similarity:512/847 (60%) Gaps:63/847 (7%)


Mouse    20 NFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLP------QIDIVNISDSFEMTYRFCSQF 78
            :.|:.|:|||||......:..|||.|:.::.....:||      ||:.::..|||....|.|...
  Fly    25 SLPDIIKIGGLFHPADDHQELAFRQAVDRINADRSILPRSKLVAQIERISPFDSFHAGKRVCGLL 89

Mouse    79 SKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPE------------LQE 131
            :.||.||||.....|.:.:.|.|..:.:..:        .|::..:||.|            |.:
  Fly    90 NIGVAAIFGPQSSHTASHVQSICDNMEIPHL--------ENRWDYRLRRESCLVNLYPHPNTLSK 146

Mouse   132 ALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEEG-YRMLFQDLEKK 195
            |.:.|:.|:.|:||..||:.:.|:..||.:|.......:.:|   :...::.| ||.|.:.::..
  Fly   147 AYVDIVRHWGWKTFTIIYENNDGIVRLQELLKAHGMTPFPIT---VRQLSDSGDYRPLLKQIKNS 208

Mouse   196 KERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTD 260
            .|..:|:||.:||::.:|.|..::......:.|::.:|....::|::|:..|.|:|||:|:|  :
  Fly   209 AEAHIVLDCSTERIHEVLKQAQQIGMMSDYHSYLVTSLDLHTVNLDEFRYGGTNITGFRLIN--E 271

Mouse   261 TIPARIMQQWRTSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSL-RRQRIDISRRGNAGDCL 324
            .|.:.:::||...:.......:....:..:||.||.|.:.|:|...| ..|:|||......|.. 
  Fly   272 KIVSDVVRQWSIDEKGLLRSANLTTVRSETALMYDAVHLFAKALHDLDTSQQIDIHPISCDGQS- 335

Mouse   325 ANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNE--DDK 387
                 .|..|..:...::.|..:|||..::|:.:|.||::.|.::|:...||||||.||.  .|.
  Fly   336 -----TWQHGFSLINYMKIVEMKGLTNVIKFDHQGFRTDFMLDIVELTPAGIRKIGTWNSTLPDG 395

Mouse   388 FVPAATDAQAGGD-NSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVG 451
            .....|.:|...: .::::|:|.:|||||.:||.|.|::|....|||::|||.|:|..||:|.:|
  Fly   396 INFTRTFSQKQQEIEANLKNKTLVVTTILSNPYCMRKESAIPLSGNDQFEGYAVDLIHEISKSLG 460

Mouse   452 YSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISI 516
            ::|::::|.||.||:.:..|..||||:.||:..|||:|:|.||||..||:.:||:.|||:||:||
  Fly   461 FNYKIQLVPDGSYGSLNKLTGEWNGMIRELLEQRADLAIADLTITFEREQAVDFTTPFMNLGVSI 525

Mouse   517 MIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEW------HSEEFEEGRD 575
            :.:||.|..|.:||||.||:.::|:.:..||:||||:||::::|:||||      |.|:.|    
  Fly   526 LYRKPIKQPPNLFSFLSPLSLDVWIYMATAYLGVSVLLFILAKFTPYEWPAYTDAHGEKVE---- 586

Mouse   576 QTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTV 640
                   ::|.:.|.:||::|:.||||||..|::||.|:|.|:|||||||:||||||||||||||
  Fly   587 -------SQFTLLNCMWFAIGSLMQQGCDFLPKALSTRMVAGIWWFFTLIMISSYTANLAAFLTV 644

Mouse   641 ERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMI 705
            |||.|||||||||||||.|.||.|:.|||..|||.|||:.:::||::|:||.||||..:..||:.
  Fly   645 ERMDSPIESAEDLAKQTRIKYGALKGGSTAAFFRDSKISTYQRMWSFMESARPSVFTASNGEGVE 709

Mouse   706 RVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQ 770
            ||.|.||.||:|:|||..||:.:|. |:..:|||.||:|.||||||..|..|..:|..:|||.|:
  Fly   710 RVAKGKGSYAFLMESTSIEYVTERN-CELTQVGGMLDTKSYGIATPPNSPYRTAINSVILKLQEE 773

Mouse   771 GVLDKLKSKWWYDK---GECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKS 832
            |.|..||:|||.:|   |:|..:.|.|....:.|.|:||.|||.:|:||:|:|.::|:.||.:||
  Fly   774 GKLHILKTKWWKEKRGGGKCRVETSKSSSAANELGLANVGGVFVVLMGGMGVACVIAVCEFVWKS 838

Mouse   833 R 833
            |
  Fly   839 R 839

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 105/385 (27%)
ANF_receptor 37..372 CDD:279440 91/355 (26%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 205/390 (53%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 151/288 (52%)
Glutamate binding. {ECO:0000250} 668..669 1/1 (100%)
PDZ-binding 904..907
KaiR1DNP_650925.1 PBP1_iGluR_Kainate 31..397 CDD:107377 105/385 (27%)
ANF_receptor 42..378 CDD:279440 91/355 (26%)
Periplasmic_Binding_Protein_Type_2 415..785 CDD:304360 203/382 (53%)
Lig_chan 547..823 CDD:278489 151/288 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.