DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir93a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_650924.3 Gene:Ir93a FlyBaseID:FBgn0259215 Length:868 Species:Drosophila melanogaster

Alignment Length:888 Identity:168/889 (19%)
Similarity:315/889 (35%) Gaps:236/889 (27%)


Mouse    88 FYERRTVNMLTSFCGALHV--CFITPSFPVDTSNQFVLQL--------RPELQEALISIIDHYKW 142
            ::....|.:...|..|:.|  |..|.:|..:|....:|.:        |..|..||:..|     
  Fly    82 YFSWNAVRLKKDFLAAITVTDCENTWNFYKNTQETSILLIAITDSDCPRLPLNRALMVPI----- 141

Mouse   143 QTFVYIYDADRGLSVLQRVLDTAAEK--NWQVTAVNILTTTEEGYRMLFQDL------------- 192
                    .:.|....|.:||...::  ||:...|.:..|..|...:|.:.:             
  Fly   142 --------VENGDEFPQLILDAKVQQILNWKTAVVFVDQTILEENALLVKSIVHESITNHITPIS 198

Mouse   193 -------------------------------EKKKERLVVVDCESERLNAILGQIVKLEKNGIGY 226
                                           |:.:::.:|:....|       .|:::.:....:
  Fly   199 LILYEINDSLRGQQKRVALRQALSQFAPKKHEEMRQQFLVISAFHE-------DIIEIAETLNMF 256

Mouse   227 H-------YIL------ANLGFMDIDLNKFKESGANVT---------------------GFQLVN 257
            |       ::|      .:.|.:.|:|    :.|||:.                     ...|||
  Fly   257 HVGNQWMIFVLDMVARDFDAGTVTINL----DEGANIAFALNETDPNCQDSLNCTISEISLALVN 317

Mouse   258 YTDTIPARIMQQWRTSDARDHTRVDW------KRPKYTSALTY--DGVKVMAEAFQSLRRQRIDI 314
            ....|  .:.::....:..|.   :|      |:.|....|.|  :.:|..|:. .|..|.|:: 
  Fly   318 AISKI--TVEEESIYGEISDE---EWEAIRFTKQEKQAEILEYMKEFLKTNAKC-SSCARWRVE- 375

Mouse   315 SRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRT------NYTLHVIEMKH 373
                        .|:.||:.                   |.|.|.|.|      |.....|    
  Fly   376 ------------TAITWGKS-------------------QENRKFRSTPQRDAKNRNFEFI---- 405

Mouse   374 DGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGY 438
                .||||.....||  ..:..........:|.|..:.|:...|:.:|.||:|..  ...::|.
  Fly   406 ----NIGYWTPVLGFV--CQELAFPHIEHHFRNITMDILTVHNPPWQILTKNSNGV--IVEHKGI 462

Mouse   439 CVELAAEIAKHVGYSYRLEIVSDGK--------YGARDPDTKAWNGMVG-----------ELVYG 484
            .:|:..|:::.:.:||.|...|..|        .|..:.|.     :||           |:|.|
  Fly   463 VMEIVKELSRALNFSYYLHEASAWKEEDSLSTSAGGNESDE-----LVGSMTFRIPYRVVEMVQG 522

Mouse   485 -RADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYI 548
             :..:|....|:....::..::::|......|.:.:||.:.. .::.|..|...|.|.|::...:
  Fly   523 NQFFIAAVAATVEDPDQKPFNYTQPISVQKYSFITRKPDEVS-RIYLFTAPFTVETWFCLMGIIL 586

Mouse   549 GVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGR 613
            ..:..|:.::|.:|       .:|.|....|...:.|      |:..||.:|||....|.:.|||
  Fly   587 LTAPTLYAINRLAP-------LKEMRIVGLSTVKSCF------WYIFGALLQQGGMYLPTADSGR 638

Mouse   614 IVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRR-SK 677
            :|.|.||...::::::|..||.||||..:....::....|....:|....|..|:   ||.| .:
  Fly   639 LVVGFWWIVVIVLVTTYCGNLVAFLTFPKFQPGVDYLNQLEDHKDIVQYGLRNGT---FFERYVQ 700

Mouse   678 IAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKG---KYAYLLESTMNEYIEQRKPCDTMKVGG 739
            ....|....|::.|:  ::....||.:..|::.:.   .:...|:..:..:.|:.|.|.......
  Fly   701 STTREDFKHYLERAK--IYGSAQEEDIEAVKRGERINIDWRINLQLIVQRHFEREKECHFALGRE 763

Mouse   740 NLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWY-----DKGECGSKDSGSKDKTS 799
            :...:...:..|..||....||..:..:...|.:::     |:     ..|:|..|.:..:....
  Fly   764 SFVDEQIAMIVPAQSAYLHLVNRHIKSMFRMGFIER-----WHQMNLPSAGKCNGKSAQRQVTNH 823

Mouse   800 ALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGF 842
            .:::.::.|.|.:|:.|..||:|:...||.|:....|::.:.|
  Fly   824 KVNMDDMQGCFLVLLLGFTLALLIVCGEFWYRRFRASRKRRQF 866

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 66/405 (16%)
ANF_receptor 37..372 CDD:279440 61/388 (16%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 87/410 (21%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 62/288 (22%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir93aNP_650924.3 Periplasmic_Binding_Protein_Type_2 429..>697 CDD:328725 68/292 (23%)
Lig_chan 576..836 CDD:306551 60/283 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111297746
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.