DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir92a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001097845.2 Gene:Ir92a FlyBaseID:FBgn0038789 Length:678 Species:Drosophila melanogaster

Alignment Length:610 Identity:110/611 (18%)
Similarity:195/611 (32%) Gaps:225/611 (37%)


Mouse   318 GNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYW 382
            |.||:...:|.      .||...|...:|.|..||:                    |.:..    
  Fly   185 GGAGNKTTSPY------RDINFELWTQKFVGAVGNL--------------------DALLL---- 219

Mouse   383 NEDDKFVPAATDAQA----GGDNSSVQNRTYIVTTILEDPYVMLK-----------------KNA 426
               |.|:|..|.|..    .....::|.|:.:|.:|...||.:..                 ..:
  Fly   220 ---DAFLPNETFANRVELYPNKLLNLQRRSLLVGSITYVPYTITNYVPAGQGDVDPIHPQWPNRS 281

Mouse   427 NQFEGNDRYEGYCVELAAEIAK--------HVGYSYRLEIVSDGKYGARD----PDTKAWNGMVG 479
            ..|:|.:          |.:.|        |:    |:|     .|||.:    .|.::.:||:|
  Fly   282 LTFDGAE----------ANVMKTFCQVHNCHL----RVE-----AYGADNWGGIYDNESSDGMLG 327

Mouse   480 ELVYGRADVAVAPL----------TITLVREEVIDFS---KPFMSLGISIMIKKPQKSKPGVFSF 531
            ::...|.::|:..:          :.|:.|..|....   .|..|...:||              
  Fly   328 DIYEQRVEMAIGCIYNWYDGITETSHTIARSSVTILGPAPAPLPSWRTNIM-------------- 378

Mouse   532 LDPLAYEIWMCIVFAYIGVSVVLFLVS------RFSPYE---WHSEEFEEGRDQTTSDQSNEFGI 587
              |.....|:.::...:.....|:.:.      |:|..:   .||.:.|:               
  Fly   379 --PFNNRAWLVLISTLVICGTFLYFMKYVSYRLRYSGTQVKFHHSRKLEK--------------- 426

Mouse   588 FNSLWFSLGAFMQQGC------DISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSP 646
              |:......|:||..      ..:||.....|:..     |:.:.:.|:..|.:.||.....:|
  Fly   427 --SMLDIFALFIQQPSAPLSFDRFAPRFFLATILCA-----TITLENIYSGQLKSMLTFPFYSAP 484

Mouse   647 IESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSK 711
            :::.|..|          ::|                 |.:  ||...::|.|.:...:...:..
  Fly   485 VDTIEKWA----------QSG-----------------WKW--SAPSIIWVHTVQSSDLETEQIL 520

Mouse   712 GK------YAYLLE-STMNEY---IEQRKPCDTMKVGGNLDSKG--------------YGIATP- 751
            .:      |:||.. |.|..|   || |....::.||..:.::.              |..|.. 
  Fly   521 ARNFEVHDYSYLSNVSFMPNYGFGIE-RLSSGSLSVGDYVSTEALENRIVLHDDLYFDYTRAVSI 584

Mouse   752 KGSALRGPVNLAVLKLSEQGV------------LDKLKSKWWYDKGECGSKDSGSKDKTSALSLS 804
            :|..|...:|..:....|.|:            :||.|.:...|... |.|..|:   ..||.:.
  Fly   585 RGWILMPELNKHIRTCQETGLYFHWELEFIDKYMDKKKQEVLMDLAN-GHKVKGA---PQALDVR 645

Mouse   805 NVAGVFYILIGGL---GLAMLVALI 826
            |:||..::|..|:   |.|::..|:
  Fly   646 NIAGALFVLAFGVAFAGCALVAELL 670

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 14/71 (20%)
ANF_receptor 37..372 CDD:279440 11/54 (20%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 79/475 (17%)
Glutamate binding. {ECO:0000250} 492..494 0/12 (0%)
Lig_chan 538..817 CDD:278489 60/331 (18%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir92aNP_001097845.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111188132
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.