DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir87a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_650290.2 Gene:Ir87a FlyBaseID:FBgn0038153 Length:796 Species:Drosophila melanogaster

Alignment Length:494 Identity:80/495 (16%)
Similarity:151/495 (31%) Gaps:124/495 (25%)


Mouse   381 YWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAE 445
            |...||:   :..|....||.:.....|                   |..|..:..|...|:...
  Fly   377 YGESDDE---SYADPGEDGDGAIPDTET-------------------QSGGKLKLSGIEYEMVQT 419

Mouse   446 IAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFM 510
            ||:.:..|..::..:...|           .:..:|:.|..::.|..:.......:.:..|.|:.
  Fly   420 IAERLHVSIEMQGENSNLY-----------HLFQQLIDGEIEMIVGGIDEDPSISQFVSSSIPYH 473

Mouse   511 SLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRD 575
            ...::..:.: .|.:.|.|:|:.....:....|....:..|:|::|..|.|.::..         
  Fly   474 QDELTWCVAR-AKRRHGFFNFVATFNADAGFLIGIFVVTCSLVVWLAQRVSGFQLR--------- 528

Mouse   576 QTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTV 640
                   |..|.|.:....||..:.|........::.|.:..:.:.......::|.:.|.:.||.
  Fly   529 -------NLNGYFPTCLRVLGILLNQAIPAQDFPITLRQLFALSFLMGFFFSNTYQSFLISTLTT 586

Mouse   641 ERMVSPIESAEDLAKQTEIAYGTLE----AGSTKEFFR--RSKIAVFEKMWTYMKSAEPSVFV-- 697
            .|....|.:.:::........||.|    .....|.|:  |.|..:...:...:..|..:..:  
  Fly   587 PRSSYQIHTLQEIYSNKMTVMGTSEHVRHLNKDGEIFKYIREKFQMCYNLVDCLNDAAQNEHIAV 651

Mouse   698 -----------RTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATP 751
                       |...:.:....:.:..|.||:               ||.:             |
  Fly   652 AVSRQHSFYNPRIQRDRLYCFDRRESLYVYLV---------------TMLL-------------P 688

Mouse   752 KGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSK------------DKTSALSLS 804
            |...|...:|..:..:.|.|.:.|     |       ::|...:            |...||:..
  Fly   689 KKYHLLHQINPVIQHIIESGHMQK-----W-------ARDLDMRRMIHEEITRVREDPFKALTFD 741

Mouse   805 NVAGVFYILIGGLGLAMLVALIEFCYKS---RSESKRMK 840
            ...|......|.|.:|..|...|.||..   |:|.:..|
  Fly   742 QFRGAIAFSGGLLLVASCVFAFELCYVKYVYRTEKRERK 780

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 3/8 (38%)
ANF_receptor 37..372 CDD:279440
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 59/400 (15%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 47/310 (15%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir87aNP_650290.2 Periplasmic_Binding_Protein_Type_2 408..>475 CDD:304360 11/78 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.