DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir85a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_649833.1 Gene:Ir85a FlyBaseID:FBgn0037630 Length:605 Species:Drosophila melanogaster

Alignment Length:374 Identity:66/375 (18%)
Similarity:128/375 (34%) Gaps:96/375 (26%)


Mouse   487 DVA-----VAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFA 546
            |||     :.|.|.....|..:..::.    .:.:::.| .|:.|..::........:|..|:.:
  Fly   272 DVAMNIRFLVPDTFRKQAESTVSHTRD----DLCVIVPK-AKTAPTFWNIFRSFGSLVWALILVS 331

Mouse   547 YIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLS 611
            .:..:|..:::                        .:|.|......|: ||.......|.|.. |
  Fly   332 VLVANVFCYIL------------------------KSEVGRVPMQLFA-GALTMPMTQIPPNH-S 370

Mouse   612 GRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAK--------------------- 655
            .|:....|.:|.|:|.|::..||.:.:..:..:..|.....||:                     
  Fly   371 IRLFLIFWLYFGLLICSAFKGNLTSMMVFQPYLPDINQLGALARSHYHIIIRPRHVKHIQHFLTL 435

Mouse   656 ----QTEIAYGTLEAGSTK--EFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKY 714
                ::.|....||...|:  |..|.:.|     .:.|::....:.|...:     ||....|:.
  Fly   436 GHKHESRIREQMLEVSDTQMYEMMRNNDI-----RFAYLEKYHIARFQVNS-----RVHMHLGRP 490

Mouse   715 AYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQG---VLDKL 776
            .:.|   ||..:   .|...:.:            .|.||...|.::..:....|.|   ..|::
  Fly   491 LFHL---MNSCL---VPFHAVYI------------VPYGSPYLGFLDSLIRSSHEFGFERYWDRI 537

Mouse   777 KSKWWYDKG-ECGSKDSGS-KDKTSALSLSNVAGVFYILIGGLGLAMLV 823
            .:..:...| :..::..|| .|:...|.|.:...||.:.:.|:|:|.:|
  Fly   538 MNSAFIKSGVKVVNRRRGSGNDEPVVLKLQHFHAVFALWLVGIGMACIV 586

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385
ANF_receptor 37..372 CDD:279440
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 55/336 (16%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 54/311 (17%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir85aNP_649833.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111188013
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.