DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir84a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_649720.2 Gene:Ir84a FlyBaseID:FBgn0037501 Length:644 Species:Drosophila melanogaster

Alignment Length:621 Identity:137/622 (22%)
Similarity:243/622 (39%) Gaps:142/622 (23%)


Mouse   280 RVDWKRPK----------YTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPW--- 331
            ||.:.||:          |.|..|  .|.|:......:|||...::  ..||  ..|.::.|   
  Fly    75 RVQFYRPEMSANFEDLMFYGSPRT--AVLVLNSEHVLVRRQVFGVA--SEAG--YFNNSLAWFIL 133

Mouse   332 GQG---IDIQRALQQV----RFEGLTGNVQFNEKG---------------RRTNYTLHVIEMKHD 374
            |.|   :.:::.:.|:    |. |:..::....:|               |:.|..| :||.|  
  Fly   134 GSGRESLPVEQLIDQLLSGYRM-GIDADITVALRGPDNASMLFYDVYRISRQANTPL-IIEKK-- 194

Mouse   375 GIRKIGYWNEDDKFVPAATDAQAGGD--NSSVQNR------TYIVTTIL-EDP-------YVMLK 423
                 |.|.....:       |..|:  |:.|..|      |.|.:|:| |.|       |:...
  Fly   195 -----GLWTHSGGY-------QKFGNFKNTWVIRRRNFLNVTLIGSTVLTEKPPGFGDMEYLADD 247

Mouse   424 KNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADV 488
            |...|.:...|......:|...:     ::..|.|....|:|.. .|..:|:|::|::....||.
  Fly   248 KQLQQLDPMQRKTYQLFQLVERM-----FNLSLAISLTDKWGEL-LDNGSWSGVMGQVTSREADF 306

Mouse   489 AVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVV 553
            ||.|:...|.|:..:.:|....:..|..:.:.|::|..... |.:||:.::|.|::....|.:::
  Fly   307 AVCPIRFVLDRQPYVQYSAVLHTQNIHFLFRHPRRSHIKNI-FFEPLSNQVWWCVLALVTGSTIL 370

Mouse   554 LFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFS-LGAFMQQGCDISP-----RSLSG 612
            |.              |....::..|:..|.|..   :||: |..::|||    |     |..|.
  Fly   371 LL--------------FHVRLERMLSNMENRFSF---VWFTMLETYLQQG----PANEIFRLFST 414

Mouse   613 RIVGGVWWFFTLIIISSYTANLAAFLTVE--RMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRR 675
            |::..:...|:.:::..|.|.:...|..|  |.:..:::..|    :.:|.|..........|..
  Fly   415 RLLISLSCIFSFMLMQFYGAFIVGSLLSESARSIVNLQALYD----SNLAIGMENISYNFPIFTN 475

Mouse   676 SKIAVFEKMWT--YMKSAEPSVFVRTTEEGMIRVRKSKGKYAY----------LLESTMNEYIEQ 728
            :...:...::.  ..||.|.::.  :.::|..|:  .:|::|:          |||..|:|    
  Fly   476 TSNQLVRDVYVKKICKSGEHNIM--SLQQGAERI--IQGRFAFHTAIDRMYRLLLELQMDE---- 532

Mouse   729 RKPCDTMKVGGNL--DSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKD 791
            .:.||..:|..||  ||   |...||||..|..:..|:|.....|:|.....||...:.:|    
  Fly   533 AEFCDLQEVMFNLPYDS---GSVMPKGSPWREHLAHALLHFRATGLLQYNDKKWMVRRPDC---- 590

Mouse   792 SGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIE 827
            |..|...:.:.|.:.|...:.|...:..:.||.|:|
  Fly   591 SLFKTSQAEVDLEHFAPALFALALAMVASALVFLLE 626

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 30/144 (21%)
ANF_receptor 37..372 CDD:279440 27/127 (21%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 93/417 (22%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 65/301 (22%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir84aNP_649720.2 nt_trans <54..>112 CDD:294020 10/39 (26%)
Periplasmic_Binding_Protein_Type_2 222..583 CDD:304360 91/404 (23%)
Lig_chan 355..602 CDD:278489 62/287 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111361164
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.