DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir76b

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_649176.1 Gene:Ir76b FlyBaseID:FBgn0036937 Length:636 Species:Drosophila melanogaster

Alignment Length:591 Identity:130/592 (22%)
Similarity:221/592 (37%) Gaps:134/592 (23%)


Mouse   365 TLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDN---SSVQNRTYIVTTILEDPYVMLKKNA 426
            ||..|..|...:|::..|              .||.:   :::::.....|.:||:         
  Fly    62 TLETINRKKPKLREMLDW--------------IGGKHLRIATLEDFPLSYTEVLEN--------- 103

Mouse   427 NQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVA 491
                |.....|...::...:.|...::|.:.:..|...|:.....::...||..   ...|:|.|
  Fly   104 ----GTRVGHGVSFQIIDFLKKKFNFTYEVVVPQDNIIGSPSDFDRSLIEMVNS---STVDLAAA 161

Mouse   492 PLTITLVREEVIDFSKPFMSLGISIMI-KKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLF 555
            .:.....:...:.:|...:..|..||: ::|::|..| ...|.|..:.:|:.|:.:.:.|..:::
  Fly   162 FIPSLSDQRSFVYYSTTTLDEGEWIMVMQRPRESASG-SGLLAPFEFWVWILILVSLLAVGPIIY 225

Mouse   556 LVSRFSPYEWHSEEFEEGRDQTTSD-QSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVW 619
            .:...             |::.|.| |...:.:.:..||..||.|:||..:||.:.|.|::...|
  Fly   226 ALIIL-------------RNRLTGDGQQTPYSLGHCAWFVYGALMKQGSTLSPIADSTRLLFATW 277

Mouse   620 WFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKM 684
            |.|..|:.|.|||||.||||:.:...|..:..|:.              ||           .|.
  Fly   278 WIFITILTSFYTANLTAFLTLSKFTLPYNTVNDIL--------------TK-----------NKH 317

Mouse   685 WTYMKSAEPSVFVRTTEEGMIRV-RKSKGKYAYLLEST-----MNEYIEQ--------RKPCDTM 735
            :..|:.......:|||.|.:..: |..:..||...:.|     :..|:|:        |...:.|
  Fly   318 FVSMRGGGVEYAIRTTNESLSMLNRMIQNNYAVFSDETNDTYNLQNYVEKNGYVFVRDRPAINIM 382

Mouse   736 --------KVGGNLDSKGY---------------GIATPKGSALRGPVNLAVLKLSEQGVLDKLK 777
                    |.....|.|.:               ..|.|.||.|....:..:|.|.|.|::..| 
  Fly   383 LYRDYLYRKTVSFSDEKVHCPFAMAKEPFLKKKRTFAYPIGSNLSQLFDPELLHLVESGIVKHL- 446

Mouse   778 SKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYK---SRSESKR- 838
            ||......|...:|.|..::  .|...::...:||::.|...|:.|...|..::   ||.|:.: 
  Fly   447 SKRNLPSAEICPQDLGGTER--QLRNGDLMMTYYIMLAGFATALAVFSTELMFRYVNSRQEANKW 509

Mouse   839 -MKGFCLIPQQSINEAIRTSTLPR-----NSGAG-ASGGSGSGENGRVVSQDFPKSMQSIPCMSH 896
             ..|....|.   .:::..|...|     |||.| ..|.|..|:|   |:.  |...||| ....
  Fly   510 ARHGIGRTPN---GQSVAPSRWLRGWRRLNSGHGQLLGASTHGQN---VTP--PPPYQSI-FNGG 565

Mouse   897 SSGMPL 902
            |.|.||
  Fly   566 SHGDPL 571

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 6/24 (25%)
ANF_receptor 37..372 CDD:279440 3/7 (43%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 89/420 (21%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 72/317 (23%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir76bNP_649176.1 Periplasmic_Binding_Protein_Type_2 83..437 CDD:304360 82/409 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111297707
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.