DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir76a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001097647.3 Gene:Ir76a FlyBaseID:FBgn0260874 Length:646 Species:Drosophila melanogaster

Alignment Length:257 Identity:54/258 (21%)
Similarity:96/258 (37%) Gaps:51/258 (20%)


Mouse   476 GMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSF---LDPLAY 537
            |:||.::..|.|..|..:.:.....|.:|.:......|::.::..|.:    :.|:   |.|..:
  Fly   299 GLVGMILDRRNDYGVGGMYLWYEAYEYMDMTHFLGRSGVTCLVPAPNR----LISWTLLLRPFQF 359

Mouse   538 EIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQG 602
            .:|||::...:..|:.|.:..|     |.......|....:   |..||..:    :|..|:.|.
  Fly   360 VLWMCVMLCLLLESLALGITRR-----WEHSSVAAGNSWIS---SLRFGCIS----TLKLFVNQS 412

Mouse   603 CDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAG 667
            .:....|.:.|.|....:...:|:.:.|:..|||.||:..:....:|.:.|.....|..||.:|.
  Fly   413 TNYVTSSYALRTVLVASYMIDIILTTVYSGGLAAILTLPTLEEAADSRQRLFDHKLIWTGTSQAW 477

Mouse   668 STKEFFRRSKIAVFEKMWTYMKSAEP-----------------SVFVRTTEEGMIRVRKSKG 712
            .|         .:.|      :||:|                 |.|..|.:.|.:..|...|
  Fly   478 IT---------TIDE------RSADPVLLGLMEHYRVYDANLISAFSHTEQMGFVVERLQFG 524

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385
ANF_receptor 37..372 CDD:279440
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 54/258 (21%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 41/193 (21%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir76aNP_001097647.3 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111188050
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.