DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir75d

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_649074.2 Gene:Ir75d FlyBaseID:FBgn0036829 Length:675 Species:Drosophila melanogaster

Alignment Length:420 Identity:97/421 (23%)
Similarity:180/421 (43%) Gaps:64/421 (15%)


Mouse   442 LAAEIAKHVGYSYR-LEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDF 505
            |..|:|..:..||. .:.|:   ||.|.|: .:::|::|.......|:|...:.:.|.|..::||
  Fly   296 LMLELANRLNMSYNTYQTVN---YGWRQPN-GSFDGLMGRFQRYELDLAQLAIFMRLDRIALVDF 356

Mouse   506 SKPFMSLGISIMIKKPQKSK-PGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEE 569
            ......:...||.::|..|. ..:|:.  |...::|:.|:...|..:|||.|...|||:      
  Fly   357 VAETYRVRAGIMFRQPPLSAVANIFAM--PFENDVWVSILMLLIITTVVLVLELFFSPH------ 413

Mouse   570 FEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANL 634
                        :::....::|.|..||..|||..:..|:.|.||:....:...|.:.:|::||:
  Fly   414 ------------NHDMSYMDTLNFVWGAMCQQGFYVEVRNRSARIIVFTTFVAALFLFTSFSANI 466

Mouse   635 AAFLTVERMVSP---IESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMW-TYMKSAEPSV 695
            .|.|.     ||   |:|..||. |:.:..|..:....|.:|..|...|.:.:: ..:.|...::
  Fly   467 VALLQ-----SPSDAIQSLSDLG-QSPLEIGVQDTQYNKIYFTESTDPVTKNLYHKKIASKGENI 525

Mouse   696 FVRTTEEGMIRVRKSKGKYAYLLE-----STMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSA 755
            ::|.. .||.::|  .|.:||.:|     ..:::...:.:.|..|:: .........|.|.|...
  Fly   526 YMRPL-LGMEKMR--TGLFAYQVELQAGYQIVSDTFSEPEKCGLMEL-EPFQLPMLAIPTRKNFP 586

Mouse   756 LRGPVNLAVLKLSEQGVLDKLKSKWWYDKGEC-----GSKDSGSKDKTSALSLSNVAGVFYILIG 815
            .:..:...:....|..::::.:.||...|.:|     |....|..:...||      |:|     
  Fly   587 YKELIRRQLRWQREVSLVNREERKWIPQKPKCEGGVGGFVSIGITECRYAL------GIF----- 640

Mouse   816 GLGLAM--LVALIEFCYKSRSESKR-MKGF 842
            |.|.|:  ::.|.||.::...:..| :||:
  Fly   641 GCGAAVSFVLFLFEFIFRHFKQVYRIIKGY 670

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385
ANF_receptor 37..372 CDD:279440
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 81/356 (23%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 65/293 (22%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir75dNP_649074.2 Periplasmic_Binding_Protein_Type_2 299..>483 CDD:304360 55/213 (26%)
Lig_chan 388..644 CDD:278489 66/295 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111361184
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.