DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir75c

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_649013.3 Gene:Ir75c FlyBaseID:FBgn0261401 Length:623 Species:Drosophila melanogaster

Alignment Length:706 Identity:151/707 (21%)
Similarity:263/707 (37%) Gaps:134/707 (19%)


Mouse   185 YRML-FQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYI-------LANL--GFMDID 239
            ||:: |..||.....|:|..|.|  :......:..|.:|||...||       |||:  .::|.|
  Fly     7 YRLIVFNLLEINLSNLMVFHCWS--IKEAFPLVEMLNQNGIFSQYIDVQNPDNLANVHKEYLDSD 69

Mouse   240 LNK---FKESGANVTGFQLVNYTDTIPARIMQQWRTSDARDHTRVDWKRPKYTSALTYDGVKVMA 301
            |.:   |.:.|.:..  :||. ..:..||:..|          .:.|        |.||......
  Fly    70 LVRLGVFLDLGCDKA--ELVT-NQSSRARLYNQ----------NLHW--------LLYDEAGNFT 113

Mouse   302 EAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQR-ALQQVRFEGLTGNVQFNEKGRRTNYT 365
            :..|......:.:           |..|.:....|.:| .|..|..:|       :..|.:.|.|
  Fly   114 KLTQLFEGANLSL-----------NADVTYVSREDEERFILHDVYNKG-------SHLGGKLNIT 160

Mouse   366 L-HVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQF 429
            : ..::......:...|.:|    :......|...|.|||..|...:.::|  |....::...:|
  Fly   161 VDQTLQCNRSHCQVKEYLSE----LHLRPRLQHRMDLSSVTFRLAALVSVL--PINSSEEELLEF 219

Mouse   430 EGNDR--YEGYCVELAAEIAKHVG--YSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAV 490
            ..:||  :......:...:..|..  ..::|..:..|.:..:|    |:.|.:|.|....|::..
  Fly   220 LNSDRDSHMDSISRIGNRLIMHTQEILGFKLHYIWCGTWSVQD----AFGGAIGMLTNESAELCT 280

Mouse   491 APLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLF 555
            .|...:..|...:.............|.:.|..:......||:|....:|.......|...|:|:
  Fly   281 TPFVPSWNRLHYLHPMTEQAQFRAVCMFRTPHNAGIKAAVFLEPFMPSVWFAFAGLLIFAGVLLW 345

Mouse   556 LVSRFSPYEWHSEE--FEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGV 618
            ::       :|.|.  .:...|...|       :.:|...|.||...||..:.|:|..||:.   
  Fly   346 MI-------FHLERHWMQRCLDFIPS-------LLSSCLISFGAACIQGSYLMPKSAGGRLA--- 393

Mouse   619 WWFFTLIIISSYTANLAAFLTVERMV-SPIESAEDLAKQTEIAYGTLEAG-----STKEFF---R 674
              |..:::.|....|....:.|..:: ||:.|  ::....::|..:|:.|     .||.:.   .
  Fly   394 --FIAVMLTSFLMYNYYTSIVVSTLLGSPVRS--NIRTIQQLADSSLDVGFDTVPFTKTYLVSSP 454

Mouse   675 RSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLE-STMNEYIEQ----RKPCDT 734
            |..|....|.....|....||:: :.|||:||||...| :.|..| |.|..::|:    |:..|.
  Fly   455 RPDIRSLYKQKVESKRDPNSVWL-SPEEGVIRVRDQPG-FVYTSEASFMYHFVEKHYLPREISDL 517

Mouse   735 MKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTS 799
            .::....:|..||: ....|..|..:....:::.|.|:..| :|:::            ||.|..
  Fly   518 NEIILRPESAVYGM-VHLNSTYRQLLTQLQVRMLETGITSK-QSRFF------------SKTKLH 568

Mouse   800 ALSLSNV--------AGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQ 847
            ..|.|.|        |.:|..|:....||:|:.::|.|: :|...|:..  .:|||
  Fly   569 TFSNSFVIQVGMEYAAPLFISLLVAYFLALLILILEICW-ARYAKKKFS--TIIPQ 621

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 45/219 (21%)
ANF_receptor 37..372 CDD:279440 43/202 (21%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 82/401 (20%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 69/303 (23%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir75cNP_649013.3 Lig_chan 328..553 CDD:306551 57/249 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111036334
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.