DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir75a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_649012.2 Gene:Ir75a FlyBaseID:FBgn0036757 Length:629 Species:Drosophila melanogaster

Alignment Length:472 Identity:98/473 (21%)
Similarity:186/473 (39%) Gaps:82/473 (17%)


Mouse   402 SSVQNRT-------------YIVTTILEDPYVMLKKNANQF--EGNDRYEGYCVELAAEIAKHVG 451
            ||:|.|:             .:.|.:.:.|..:......:|  :.||.:    ::..|....|:.
  Fly   187 SSLQKRSKYGNREQLTDVVLRVATVVTQRPLTLSDDELIRFLSQENDTH----IDSLARFGFHLT 247

Mouse   452 YSYRLEIVSDGKYGARDPDTKAWN------GMVGELVYGRADVAVAPLTITLVREEVIDFSKPFM 510
            ...|..:....|:...|    :|:      |.||.:|...||:...|   :|..|..:.:....:
  Fly   248 LILRDLLHCKMKFIFSD----SWSKSDVVGGSVGAVVDQTADLTATP---SLATEGRLKYLSAII 305

Mouse   511 SLGI--SIMI-KKPQKSKPGVFSFLDPLAYEIWMCI--VFAYIGVS--VVLFLVSRFSPYEWHSE 568
            ..|.  |:.| :.|..:......||.|.:..:|...  |.:.|||.  :..::..:.....|..:
  Fly   306 ETGFFRSVCIFRTPHNAGLRGDVFLQPFSPLVWYLFGGVLSLIGVLLWITFYMECKRMQKRWRLD 370

Mouse   569 EFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTAN 633
            ...              .:.::...|.||...|...:.|||..||::     :|.|.:||....|
  Fly   371 YLP--------------SLLSTFLISFGAACIQSSSLIPRSAGGRLI-----YFALFLISFIMYN 416

Mouse   634 LAAFLTVERMV-SPIESAEDLAKQTEIAYGTLEAG-----STKEFFRRSK---IAVFEKMWTYMK 689
            ....:.|..:: ||::|  .:....::|..:|..|     .||.:...|:   |.:|.|.....:
  Fly   417 YYTSVVVSSLLSSPVKS--KIKTMRQLAESSLTVGLEPLPFTKSYLNYSRLPEIHLFIKRKIESQ 479

Mouse   690 SAEPSVFVRTTEEGMIRVRKSKGKYAYLLEST-----MNEYIEQRKPCDTMKVGGNLDSKGYGIA 749
            :..|.::: ..|:|::|||.:.| |.|:.|::     :..|...::.||..:|....:...| ..
  Fly   480 TQNPELWL-PAEQGVLRVRDNPG-YVYVFETSSGYAYVERYFTAQEICDLNEVLFRPEQLFY-TH 541

Mouse   750 TPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILI 814
            ..:.|..:....|..|::.|.||..|.:|.|.:.|..|.:::.     ...:.:..||.:..:||
  Fly   542 LHRNSTYKELFRLRFLRILETGVYRKQRSYWVHMKLHCVAQNF-----VITVGMEYVAPLLLMLI 601

Mouse   815 GGLGLAMLVALIEFCYK 831
            ....|.:::.|:|..:|
  Fly   602 CADILVVVILLVELAWK 618

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385
ANF_receptor 37..372 CDD:279440
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 86/423 (20%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 63/297 (21%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir75aNP_649012.2 Lig_chan 337..603 CDD:306551 63/295 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111036309
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.