DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir68b

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_648548.1 Gene:Ir68b FlyBaseID:FBgn0036250 Length:635 Species:Drosophila melanogaster

Alignment Length:756 Identity:126/757 (17%)
Similarity:227/757 (30%) Gaps:254/757 (34%)


Mouse   165 AAEKNWQVT----AVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIG 225
            |.|:|.|||    ..:...:.:..|..|..||.:         |...||..|...:...|     
  Fly    27 AVEQNVQVTYLYRCASCPASFDADYSALELDLYR---------CVGSRLPVITRNMEAHE----- 77

Mouse   226 YHYILANLGFMDIDLNKFKESGANVTGFQL--VNYTDTIPARIMQQWRTSDARDHTRVDWKRPKY 288
                          |..|:.:. :::.||:  ....|::..||:........|.|..      ||
  Fly    78 --------------LEPFRRTD-SLSIFQIPAAEKGDSLVRRILDMLNPHQRRKHMH------KY 121

Mouse   289 TSALTYDGVKVMAEAFQSLRRQRI--DISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTG 351
            .......|...:...|:....:::  .::..|............||....|||         |.|
  Fly   122 LFVWPNAGRHQLLRLFRGSWAKKLLYGLAITGRENGTFDFDPFAWGGLQVIQR---------LDG 177

Mouse   352 NVQFNEKG--------RRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGD--NSSVQN 406
            .|.:..|.        |.:.:|..::.|....:...||...|      ...|:..|:  |:||  
  Fly   178 EVPYARKVKDLRGYPLRFSMFTDPLMAMPRSPVETAGYQAVD------GVAARVVGEMLNASV-- 234

Mouse   407 RTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDT 471
             ||:..                 |.|:.| |.|                   :.:|.|       
  Fly   235 -TYVFP-----------------EDNESY-GRC-------------------LPNGNY------- 254

Mouse   472 KAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKS-KPGVFSFLDPL 535
               .|:|.::|.|....|.....:.......::...|:....:.:::  |..: :|....|:...
  Fly   255 ---TGVVSDIVGGHTHFAPNSRFVLDCIWPAVEVLYPYTRRNLHLVV--PASAIQPEYLIFVRVF 314

Mouse   536 AYEIWMCIVFAYIGVSVVLFLVSRFS-----------PYEWHSEEFEEGRDQTTSDQSNEFGIFN 589
            ...:|..::...:.|.:|.:::.|..           ...|: |..|........:.:.....|:
  Fly   315 RRTVWYLLLVTLLVVVLVFWVMQRLQRRIPRRGVIQFQATWY-EILEMFGKTHVGEPAGRLSSFS 378

Mouse   590 SL-WFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDL 653
            |: .|.:|                      |..|:.::.:.|.|.|.:..........::..:||
  Fly   379 SMRTFLMG----------------------WILFSYVLSTIYFAKLESGFVRPSYEEQVDRVDDL 421

Mouse   654 ------------------AKQTEIAYGTLEAGS--------------------------TKEFFR 674
                              :..||..||.||..|                          .::|..
  Fly   422 VHLDVHIYAVTTMYDAVRSALTEHQYGLLENRSRQLPLGIATSYYQPVVRRRDRRAAFIMRDFHA 486

Mouse   675 RSKIAVFEKMWTYMKSAEPSVF--VRTTEEGMI--RVRKSKGKYAYLLESTMNEYIEQ------R 729
            |..:|:     ||...||...:  .|.....||  .:......:.:.|||..:.::|.      |
  Fly   487 RDFLAI-----TYDSQAERPAYHIAREYLRSMICTYILPRGSPFLHRLESLYSGFLEHGFFEHWR 546

Mouse   730 KPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGS 794
            :.....:||.:.|::                                  ::..|.|:....||||
  Fly   547 QMDLITRVGASPDAE----------------------------------EFLEDLGDQTDTDSGS 577

Mouse   795 -----KDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCY 830
                 ::|...|:|..:.|.||:...|:|::.|...:|..:
  Fly   578 NELAIRNKKVVLTLDILQGAFYLWSVGIGISCLGFAVEHAH 618

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 44/240 (18%)
ANF_receptor 37..372 CDD:279440 41/223 (18%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 63/448 (14%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 56/350 (16%)
Glutamate binding. {ECO:0000250} 668..669 1/27 (4%)
PDZ-binding 904..907
Ir68bNP_648548.1 Lig_chan 333..607 CDD:278489 54/336 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C109695595
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.