DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir68a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_648455.2 Gene:Ir68a FlyBaseID:FBgn0036150 Length:704 Species:Drosophila melanogaster

Alignment Length:822 Identity:151/823 (18%)
Similarity:284/823 (35%) Gaps:254/823 (31%)


Mouse   104 LHVCFIT----PSFPVDTSNQ-----FVLQLRPELQEALISIIDHYKW-----QTFVYIYDADRG 154
            |.|.||:    .|.|:..:|.     :.:||:..||:.|        |     :.|..|.| |..
  Fly     7 LIVAFISLAMATSIPIPIANPAPLSGYEMQLKILLQKIL--------WVANVKRCFAVITD-DLH 62

Mouse   155 LSVLQRVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVV-------DCESERLNAI 212
            ..:..|:...:..:  :|....::.|.|.      .||::...::.:.       |||...:..:
  Fly    63 YPIYDRIFFESVGR--RVIPFFVMRTNES------DDLQRPSRQVELFVKAIKSSDCELNVITIL 119

Mouse   213 LG-QIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIMQQWRT-SDA 275
            .| |:.:.    :||.|       .:..||..|:       |.|::......:.::..|.. .||
  Fly   120 NGWQVQRF----LGYIY-------DNRSLNMQKK-------FVLLHDLRLFESDMIHLWSVFIDA 166

Mouse   276 RDHTRVDWKRP---KYT-SALTY----DGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWG 332
                 :..||.   ||| |.:.:    .||.||..                     :||    |.
  Fly   167 -----IFLKRQLDNKYTISTIAFPGILSGVLVMKN---------------------IAN----WE 201

Mouse   333 QGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQA 397
            .|            :||.|.:.|                                          
  Fly   202 LG------------KGLNGRILF------------------------------------------ 212

Mouse   398 GGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYS---YR---- 455
             .|.:|....|.:...|.|...::|..||.:     .::|..||:...:.|.:.:.   |:    
  Fly   213 -ADKTSNLFGTSLPVAISEHVPMVLWANATK-----SFQGVEVEIMNALGKALNFKPVYYKPNQT 271

Mouse   456 -------LEIVSDGKYGARDPDTKAWNG------MVGELVYGRADVAVAPLTITLVREEVIDFSK 507
                   |:..:...||:.:||..|.||      :|.|:....|..|:..|.:..|..::::.|.
  Fly   272 ENMDWTELDGGASVAYGSGNPDGYAQNGTHIDSMLVDEVAAHSARFAIGDLHLFQVYLKLVELSA 336

Mouse   508 PFMSLGISIMIKKPQKSKPGVF-SFLDPLAYEIWMCIVFAYIGVSVVLFLVS------------- 558
            |.....::.:  .|:.|....: :|:.|.:..:|:.::.:...|..|.:.:|             
  Fly   337 PHNFECLTFL--TPESSTDNSWQTFILPFSAGMWVGVLLSLFVVGTVFYAISFLNAIINGNVSSE 399

Mouse   559 -----------RFSPYEWHSEEFEEGRDQTTSDQSNEF------GIFNSLWFSLGAFMQQGCDIS 606
                       ...|..:....|.....:..|.:.:..      |..|.:..:....:.......
  Fly   400 FFRCLRPNRNVPMDPKIYRRISFRIAISRYRSSKGDRMPRDLFDGYTNCILLTYSMLLYVALPRM 464

Mouse   607 PRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGST-- 669
            ||:...|::.|.:|.:.::::::|.|:..|.|........|::.|||.: :.|...|   |:|  
  Fly   465 PRNWPLRVLTGWYWIYCILLVATYRASFTAILANPAARVTIDTLEDLLR-SHIPPST---GATEN 525

Mouse   670 KEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDT 734
            ::||..:...|..|:...|:     ||..:.:   :..|.:||:.||........|:..      
  Fly   526 RQFFLEANDEVARKVGEKME-----VFGYSDD---LTSRIAKGQCAYYDNEFYLRYLRV------ 576

Mouse   735 MKVGGNLDSKGYG--------------IATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKG 785
                  .|..|..              :|..|.|||:..|:.::..|:|.|::    :||..|..
  Fly   577 ------ADESGSALHIMKECVLYMPVVLAMEKNSALKPRVDASIQHLAEGGLI----AKWLKDAI 631

Mouse   786 ECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIE 827
            |....::.::.: :.:::......|..|:.|..::||..|.|
  Fly   632 EHLPAEALAQQE-ALMNIQKFWSSFVALLIGYVISMLTLLAE 672

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 57/316 (18%)
ANF_receptor 37..372 CDD:279440 57/299 (19%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 85/448 (19%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 57/325 (18%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir68aNP_648455.2 Lig_chan 429..661 CDD:278489 50/261 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111049332
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.