DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and GluRIA

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_476855.1 Gene:GluRIA FlyBaseID:FBgn0004619 Length:991 Species:Drosophila melanogaster

Alignment Length:971 Identity:380/972 (39%)
Similarity:549/972 (56%) Gaps:131/972 (13%)


Mouse    25 IQIGGLFPNQQSQEHAAFRFA-----LSQLTEPPKLLPQIDIVNISDSFEMTYRFCSQFSKGVYA 84
            |.:|.:|........:||::|     |:..:...:|...:|::|.:|:|:::...|:|||:|||:
  Fly    40 IPLGAIFEQGTDDVQSAFKYAMLNHNLNVSSRRFELQAYVDVINTADAFKLSRLICNQFSRGVYS 104

Mouse    85 IFGFYERRTVNMLTSFCGALHVCFITPSFP----VDTSN--QFVLQLRPELQEALISIIDHYKWQ 143
            :.|.....:.:.|.|:.....:.|:||.||    ..:|.  .|.:.:||:..:|:|..|.:|.||
  Fly   105 MLGAVSPDSFDTLHSYSNTFQMPFVTPWFPEKVLAPSSGLLDFAISMRPDYHQAIIDTIQYYGWQ 169

Mouse   144 TFVYIYDADRGLSVLQRVLDTAAEKN--WQVTAVNILTTTEEGYRML--FQDLEKKKERLVVVDC 204
            :.:|:||:..||..||::.......|  ::|..|..:.........|  .:||.:..::.:|:||
  Fly   170 SIIYLYDSHDGLLRLQQIYQELKPGNETFRVQMVKRIANVTMAIEFLHTLEDLGRFSKKRIVLDC 234

Mouse   205 ESERLNAILGQIVKLEKNG-IGYHYILANLGFMD----IDLNKFKESGA-NVTGFQLVNYTDTIP 263
            .:|....|:.|.|:..|.| ..|||:|:.| .||    .|:.:|   || |:|||::|:..    
  Fly   235 PAEMAKEIIVQHVRDIKLGRRTYHYLLSGL-VMDNHWPSDVVEF---GAINITGFRIVDSN---- 291

Mouse   264 ARIMQQWRTSDARDHTRVDWKRPKYT-------------SALTYDGVKVMAEAFQSLRRQRID-- 313
            .|.::.:.  |:|.......:.....             :||.||.|.|:.|||..:.|::.|  
  Fly   292 RRAVRDFH--DSRKRLEPSGQSQSQNAGGPNSLPAISAQAALMYDAVFVLVEAFNRILRKKPDQF 354

Mouse   314 ----ISRRGNAG----------------DCLANP--AVPWGQGIDIQRALQQVRFEGLTGNVQFN 356
                :.||.:.|                ||..:.  ..||.||..|.|.|::|..:||:|.::|:
  Fly   355 RSNHLQRRSHGGSSSSSATGTNESSALLDCNTSKGWVTPWEQGEKISRVLRKVEIDGLSGEIRFD 419

Mouse   357 EKGRRTNYTLHVIEMK-HDGIRKIGYWNEDDKFVPAATDAQAGGDNSSV-------QNRTYIVTT 413
            |.|||.||||||:||. :..::::..|.:|...:|..:...|....|:.       :|.||||::
  Fly   420 EDGRRINYTLHVVEMSVNSTLQQVAEWRDDAGLLPLHSHNYASSSRSASASTGDYDRNHTYIVSS 484

Mouse   414 ILEDPYVMLKK--NANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTK-AWN 475
            :||:||:.||:  ......||||:||||.:||..:|..:|..|.:.:|.||.|||.:.... .|:
  Fly   485 LLEEPYLSLKQYTYGESLVGNDRFEGYCKDLADMLAAQLGIKYEIRLVQDGNYGAENQYAPGGWD 549

Mouse   476 GMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW 540
            ||||||:...||:|::.:|||..||.|||||||||:||||||||||.|..|||||||:||:.|||
  Fly   550 GMVGELIRKEADIAISAMTITAERERVIDFSKPFMTLGISIMIKKPVKQTPGVFSFLNPLSQEIW 614

Mouse   541 MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQ---------------------SNE 584
            :.::.:|:|||.||:.|:||.||||..  ....:..:|:.|                     .||
  Fly   615 ISVILSYVGVSFVLYFVTRFPPYEWRI--VRRPQADSTAQQPPGIIGGATLSEPQAHVPPVPPNE 677

Mouse   585 FGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIES 649
            |.:.||.|:||.|||||||||:|.|::|||...||||||:|:||||||||||||||||||:||::
  Fly   678 FTMLNSFWYSLAAFMQQGCDITPPSIAGRIAAAVWWFFTIILISSYTANLAAFLTVERMVAPIKT 742

Mouse   650 AEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKY 714
            .|||..||::.||||..|||.||||||:|.:..|||.|| :|.....|.|.:||:.|||:|||||
  Fly   743 PEDLTMQTDVNYGTLLYGSTWEFFRRSQIGLHNKMWEYM-NANQHHSVHTYDEGIRRVRQSKGKY 806

Mouse   715 AYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSK 779
            |.|:||..|||:..|.||||||||.|:|:||:|:|||.||.||..:|.|||.|.|.|.|.::::|
  Fly   807 ALLVESPKNEYVNARPPCDTMKVGRNIDTKGFGVATPIGSPLRKRLNEAVLTLKENGELLRIRNK 871

Mouse   780 WWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCL 844
            ||:||.||......|  ..:.||||||||::|||||||.||::||::||             || 
  Fly   872 WWFDKTECNLDQETS--TPNELSLSNVAGIYYILIGGLLLAVIVAIMEF-------------FC- 920

Mouse   845 IPQQSINEAIRTSTLPRNSGAGASGGSGSGENGRVVSQDFPKSMQSIPCMSHSSGMPLGAT 905
                      |..| |:....|::|.:| |..|.:.|..:.:...|...|...:.:.:.|:
  Fly   921 ----------RNKT-PQLKSPGSNGSAG-GVPGMLASSTYQRDSLSDAIMHSQAKLAMQAS 969

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 119/422 (28%)
ANF_receptor 37..372 CDD:279440 115/393 (29%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 220/405 (54%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 162/300 (54%)
Glutamate binding. {ECO:0000250} 668..669 1/1 (100%)
PDZ-binding 904..907 1/3 (33%)
GluRIANP_476855.1 PBP1_iGluR_AMPA 41..453 CDD:107375 119/422 (28%)
ANF_receptor 53..434 CDD:279440 114/391 (29%)
PBP2_iGluR_AMPA 477..879 CDD:270433 220/405 (54%)
Lig_chan 612..907 CDD:278489 162/300 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111105410
eggNOG 1 0.900 E1_KOG1052
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 707 1.000 Inparanoid score I644
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000395
OrthoInspector 1 1.000 T130891
orthoMCL 1 0.900 OOG5_128645
Panther 1 1.100 O PTHR18966
Phylome 1 0.910 0.778 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
1110.760

Return to query results.
Submit another query.