DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir64a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_647962.1 Gene:Ir64a FlyBaseID:FBgn0035604 Length:859 Species:Drosophila melanogaster

Alignment Length:645 Identity:116/646 (18%)
Similarity:215/646 (33%) Gaps:206/646 (32%)


Mouse   326 NPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVP 390
            ||.:.:|..:::.........||    :|.:...|.|:.....::|:|..:|          .:.
  Fly   266 NPGLNYGGHVNLTEIGSFTPTEG----IQLHTWFRTTSTVRRRMDMQHARVR----------CMV 316

Mouse   391 AATDAQAGGDNSSVQNRT-----YIVTTILEDPYVMLKKNANQFEG-NDRYEGYCVELAAEIAKH 449
            ..|:          :|.|     |:..|:......|.:.|.|.... .|.:....|     :::.
  Fly   317 VVTN----------KNMTGTLMYYLTHTMSGHIDTMNRFNFNLLMAVRDMFNWTFV-----LSRT 366

Mouse   450 VGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGI 514
            ..:.|    |.:|::          :||:|.|:....|:..||:...|.|.:.||.:....|...
  Fly   367 TSWGY----VKNGRF----------DGMIGALIRNETDIGGAPIFYWLERHKWIDVAGRSWSSRP 417

Mouse   515 SIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVV-LFLVSRFSPYEWH------------ 566
            ..:.:.|:.::.....||.|...::|:.||    |..|: :|::...:..||.            
  Fly   418 CFIFRHPRSTQKDRIVFLQPFTNDVWILIV----GCGVLTVFILWFLTTIEWKLVPHDGSALIKP 478

Mouse   567 --------------------------------------SEEFEEGRDQTTSD----------QSN 583
                                                  .|:.||..|.|..|          :.|
  Fly   479 KGGAPPRHHYQQQQQQEQVEAPVRPITAVSVVVSKEKVEEKQEEYEDSTPIDAGTLWQRCYQKLN 543

Mouse   584 EF---------------GIF-NSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTA 632
            ::               |:| .|:.|.:|...|||...|...:|||.:......|:..|...|:|
  Fly   544 KYIKDRKAKQKKAPERVGLFLESVLFFVGIICQQGLGFSTSFVSGRCIVITSLLFSFCIYQFYSA 608

Mouse   633 NLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGS-----TKEFFRRSKIAVFEKMWTYMK--- 689
            ::...|.:|: ...|::..||      .:.:|:.|.     .:::|..:|..|  .|..|.|   
  Fly   609 SIVGTLLMEK-PKTIKTLSDL------VHSSLKVGMEDILYNRDYFLHTKDPV--SMELYAKKIT 664

Mouse   690 ---------------------SAEPSVFVR---------------------TTEEGMIRVRKSKG 712
                                 |.:|:...|                     ..|.|::|   ..|
  Fly   665 SVPTTKENEADEDEPVDPNPVSTDPAKSYRDIVHSHETGAHAKDNAASNWLDPETGLLR---HLG 726

Mouse   713 KYAYLLE-----STMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGV 772
             :|:.::     ..:.|...::..||..:|......|...| ..|.|.:|..::..:.:::|.|:
  Fly   727 -FAFHVDVAAAYKIIAETFSEQDICDLTEVSMFPPQKTVSI-MQKNSPMRKVISYGLRRVTETGI 789

Mouse   773 LDKLKSKWWYDKGECGSKDSGSKDKTSAL--SLSNVAGVFYILIGGLGLAMLVALIEFCY 830
            |....:.|...|..|     ..|.:||.|  .:..|:....||:....:.:::...|..|
  Fly   790 LTYHFNVWHSRKPPC-----VKKIETSDLHVDMDTVSSALLILLFSYAITLMILGTEILY 844

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 11/63 (17%)
ANF_receptor 37..372 CDD:279440 9/46 (20%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 94/519 (18%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 74/413 (18%)
Glutamate binding. {ECO:0000250} 668..669 0/6 (0%)
PDZ-binding 904..907
Ir64aNP_647962.1 Periplasmic_Binding_Protein_Type_2 351..>465 CDD:304360 28/137 (20%)
Lig_chan 563..828 CDD:278489 58/284 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111361140
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR18966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.