DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir60a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_611901.1 Gene:Ir60a FlyBaseID:FBgn0034994 Length:716 Species:Drosophila melanogaster

Alignment Length:741 Identity:117/742 (16%)
Similarity:241/742 (32%) Gaps:229/742 (31%)


Mouse   201 VVDCESERLNAILGQIVKLE------KNGIG---------------------YHYILANLGFMDI 238
            :|:..:|..|.::..:.:.:      |.|:|                     |:.:|.:...:..
  Fly    24 IVNLSNETANTVIFMLPEKDLGPDVWKAGVGCLDSFAQIFFFRNPKERFTRAYNLMLVHAFHLSS 88

Mouse   239 DLNKFKESGANVTGF-QLVNYTDTIPA----RIMQQWRTSDARDHTRVDWKRPKYTSALTYDGVK 298
            ..::.:|      || :|:|...|.|.    ..:.|.|.:...:.|.....:.:...|..|..|.
  Fly    89 PADQIQE------GFSKLINEAVTNPGPPDREELFQMRVASDYNITNGTEDKGELILADNYVIVV 147

Mouse   299 VMAEAFQSLRRQRIDISRRGNAGD---CLANPAV----PWGQGIDIQRALQQVRFEGLTGNVQFN 356
            ...:..:.|.:::|...|..|.|.   .|.:.|.    |.|...:|.:.|.::.:......:..|
  Fly   148 DSVDRLKELMKKKIVEMRSWNPGARFLVLFHNATCRNRPLGVASNIFKDLMEMFYVHRVALLYAN 212

Mouse   357 EKGRRTNYTLHV------IEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDN----SSVQNRTYIV 411
            .   ..||.|.|      :..:...::.:|..: |.|..|.....:|...:    .|.:|.|:..
  Fly   213 S---TMNYNLLVNDYYSNVNCRILNVQSVGQCH-DGKLYPNNAVVKASMQDYVSGFSPRNCTFFA 273

Mouse   412 TTILEDPYVM-------------LKKNANQFEGNDRYEGYC-VELAAEIAKHVGYSYRLEIVSDG 462
            .:.:..|:|.             ..||..:|:.|..    | :|...|:              ||
  Fly   274 CSSISAPFVEADCILGLEMRILGFMKNRLKFDVNQT----CSLESRGEM--------------DG 320

Mouse   463 KYGARDPDTKAWNGMVGELVYGRADVAVA---PLTITLVREEVIDF---SKPFMSLGISIMIKKP 521
            ...        |.|::|::.....|....   |      ..||.|.   |..::....:..||..
  Fly   321 PAN--------WTGLLGKVQNNECDFVFGGYYP------DNEVADHFWGSDTYLQDAHTWYIKMA 371

Mouse   522 QKSKPGVFSFLDPLAYEIWMCIV-----FAYIGVSVVLFLVSRFSPYEWHS-------EEFEEGR 574
            .: :|.            |..:|     :.:||..::|.:...|    |.:       .::.:..
  Fly   372 DR-RPA------------WQALVGIFEAYTWIGFILILIISWLF----WFTLVMILPEPKYYQQL 419

Mouse   575 DQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLT 639
            ..|.         .|:|..::...:|:    .|...:.|:.......:.|.::::||:       
  Fly   420 SLTA---------INALAVTISIAVQE----RPICETTRLFFMALTLYGLNVVATYTS------- 464

Mouse   640 VERMVSPIES---AEDLAKQTEIAYGTLEAG---STKEFFRRSKIAVFEKMWTYMKSAEPSVFVR 698
              :|::..:.   ...|.:.||:....:..|   .::::|...     :.||.:           
  Fly   465 --KMIATFQDPGYLHQLDELTEVVAAGIPFGGHEESRDWFEND-----DDMWIF----------- 511

Mouse   699 TTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGN--LDSKGYGIATP--------KG 753
                           ..|.:..   |:|.|.|..:.:|.|..  |.::.|.:.:|        ..
  Fly   512 ---------------NGYNISP---EFIPQSKNLEAVKWGQRCILSNRMYTMQSPLADVIYAFPN 558

Mouse   754 SALRGPVNL-------------AVLKL-SEQGVLDKLKSKWWYDK---GECGSKDSGSKDKTSAL 801
            :....||.:             ::::| .:.|:..|:.:.:.|:.   ...........:....|
  Fly   559 NVFSSPVQMIMKAGFPFLFEMNSIIRLMRDVGIFQKIDADFRYNNTYLNRINKMRPQFPETAIVL 623

Mouse   802 SLSNVAGVFYILIGGLGLAMLVALIE 827
            :..::.|.|:||:.|...|.|..:.|
  Fly   624 TTEHLKGPFFILVVGSCWAALTFIGE 649

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 40/233 (17%)
ANF_receptor 37..372 CDD:279440 37/216 (17%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 65/446 (15%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 46/324 (14%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir60aNP_611901.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110958525
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.