DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir40a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_610140.4 Gene:Ir40a FlyBaseID:FBgn0259683 Length:732 Species:Drosophila melanogaster

Alignment Length:533 Identity:101/534 (19%)
Similarity:205/534 (38%) Gaps:97/534 (18%)


Mouse   382 WNEDDK-------FVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYE--- 436
            |.:.|.       .:|.|....|     :.:.||:.|......|:..:....|.||.::.:.   
  Fly   189 WYDGDNLGLQRIPLLPTALSVYA-----NFKGRTFRVPVFHSPPWFWVTYCNNSFEEDEEFNSLD 248

Mouse   437 -----------GYCVELAAEIAKHVGYSYR-LEIVSDGKYGARDPDTK----AWNGMVGELVYGR 485
                       |....|...::||:.:.:: :|.....:...|..|.|    ::.|.:|.|..|:
  Fly   249 SIEKRKVRVTGGRDHRLLMLLSKHMNFRFKYIEAPGRTQGSMRSEDGKDSNDSFTGGIGLLQSGQ 313

Mouse   486 ADVAVAPLTITLVREEVIDFSKPFMSLGIS--IMIKKPQKSKPGVFSFLDPLAYEIW----MCIV 544
            ||..:..:.::..|.:.|:||  |.:|..|  .....|::....: :.:.|...:||    :.|:
  Fly   314 ADFFLGDVGLSWERRKAIEFS--FFTLADSGAFATHAPRRLNEAL-AIMRPFKQDIWPHLILTII 375

Mouse   545 FA---YIGVSVVLFLVSRFSPYEWHSEEFE----------------------EGRDQTTSDQSNE 584
            |:   :.|:..:.::..|    .|.:.:.|                      :.|...::.|...
  Fly   376 FSGPIFYGIIALPYIWRR----RWANSDVEHLGELYIHMTYLKEITPRLLKLKPRTVLSAHQMPH 436

Mouse   585 FGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWF-FTLIIISSYTANLAAFLTVERMVSPIE 648
            ......:||:|..|::|.|:........:.:..|:|. .|.::...|:|.|.:.........||.
  Fly   437 QLFQKCIWFTLRLFLKQSCNELHNGYRAKFLTIVYWIAATYVLADVYSAQLTSQFARPAREPPIN 501

Mouse   649 SAEDL-AKQTEIAYGT-LEAGSTKEFFRRSKIAVFEKMWTYMKSA---EPSVFVRTTEEGMIRVR 708
            :.:.| |......|.. :|..|:......:...:|.:::..|:..   :|..|...:.|..|::.
  Fly   502 TLQRLQAAMIHDGYRLYVEKESSSLEMLENGTELFRQLYALMRQQVINDPQGFFIDSVEAGIKLI 566

Mouse   709 KSKGKYAYLLESTMNEYIE-QRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGV 772
            ...|:...:|......:.. |:...:..::...|.::...:|...|....|.:|..:::|.|.|:
  Fly   567 AEGGEDKAVLGGRETLFFNVQQYGSNNFQLSQKLYTRYSAVAVQIGCPFLGSLNNVLMQLFESGI 631

Mouse   773 LDKLK----SKWWYD-------KGECGSKDSGSKDKT--------SALSLSNVAGVFYIL-IGGL 817
            |||:.    :|.:.:       ||...:|:|.:..:|        |.|:|..:.|.|..| :|.|
  Fly   632 LDKMTAAEYAKQYQEVEATRIYKGSVQAKNSEAYSRTESYDSTVISPLNLRMLQGAFIALGVGSL 696

Mouse   818 GLAMLVALIEFCY 830
            . |.::.|:|..:
  Fly   697 A-AGVILLLEIVF 708

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 2/14 (14%)
ANF_receptor 37..372 CDD:279440
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 82/449 (18%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 62/335 (19%)
Glutamate binding. {ECO:0000250} 668..669 1/1 (100%)
PDZ-binding 904..907
Ir40aNP_610140.4 PBP2_LTTR_substrate 216..338 CDD:330233 26/124 (21%)
Periplasmic_Binding_Protein_Type_2 297..>391 CDD:328725 20/97 (21%)
Periplasmic_Binding_Protein_Type_2 <496..637 CDD:328725 27/141 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110958505
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.