DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and clumsy

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001036373.1 Gene:clumsy FlyBaseID:FBgn0026255 Length:1002 Species:Drosophila melanogaster

Alignment Length:962 Identity:313/963 (33%)
Similarity:488/963 (51%) Gaps:98/963 (10%)


Mouse     4 IFAFFCTGFL--GAVVGANFP-NNIQIGGLFPNQQSQEHAAFRFALSQ---LTEPPKLLPQIDIV 62
            :::.|.|.||  ...|.|:.. :...:|.:|.:.:.:...|||.|:.:   |....:|:|.:...
  Fly     1 MYSLFLTHFLLIALPVLADIDRSQFMVGSIFTSDKDESEIAFRTAVDRANILERNVELVPIVVYA 65

Mouse    63 NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFI------TPSFPVDTSNQF 121
            |..|||.|....|:..|:||.||||.....:.:::.|.|..|.:..|      ..|.|....:..
  Fly    66 NTDDSFIMEKMVCNLISQGVIAIFGPSTGSSSDIIASICDTLDIPHIVYDWIPNESIPDREHSTM 130

Mouse   122 VLQLRPE---LQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEE 183
            .|.:.|:   |.:.|..|:..:.|::|..:|:.|:.|..||.:|. ..|.....|.|..|...::
  Fly   131 TLNVHPDNLLLSQGLAEIVQSFAWRSFTVVYETDKELQQLQDILQ-VGEPISNPTTVKQLGPGDD 194

Mouse   184 GYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGA 248
             :|...::::...:..:::.|..:.|..||.|..:|:..|......:..|....||..:.....|
  Fly   195 -HRPFLKEIKLSTDNCLILHCAPDNLLKILQQANELKMLGEYQSVFIPLLDTHSIDFGELSGVEA 258

Mouse   249 NVTGFQLVNYTDTIPARIMQQWRTSDARD--HTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQR 311
            |:|..:|::.:|.....::..|...:.|:  :.:||..|.|....|..|.|.:.::....|    
  Fly   259 NITTVRLMDPSDFHVKNVVHDWEEREKREGRYFKVDPNRVKSQMILLNDAVWLFSKGLTEL---- 319

Mouse   312 IDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGI 376
             .|.....|.|.......||..|..|...::....|..||.:.|||.|:|:.:||..:|:..||.
  Fly   320 -GIFEELTAPDLECRRKKPWPFGKRIIEFIKARSEETSTGRIDFNENGQRSFFTLRFMELNSDGF 383

Mouse   377 RKIGYW---------NEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLK--KNANQFE 430
            ..:..|         |:|::     ::.:.|   ..:.|:|:||::.|..|::.|:  :......
  Fly   384 LDLATWDPVNGLDVLNDDEE-----SEKRVG---QKLSNKTFIVSSRLGAPFLTLREPQEGEILT 440

Mouse   431 GNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTI 495
            ||.|||||.::|..||||.:.:.:...:..||||||.:..|:.|:|:|.:|:.|.||:.:..||:
  Fly   441 GNSRYEGYSIDLINEIAKMLNFKFEFRMSPDGKYGALNKVTQTWDGIVRQLIDGNADLGICDLTM 505

Mouse   496 TLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRF 560
            |..|.:.:||:.|||:|||||:..||......:||||.|.:.::|:.:..||:.:|::||.::|.
  Fly   506 TSSRRQAVDFTPPFMTLGISILFSKPPTPPTDLFSFLSPFSLDVWIYMGSAYLFISLLLFALARM 570

Mouse   561 SPYEWHS-------EEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGV 618
            :|.:|.:       ||.|           |.:.|.|:.|.|:|:.|.|||||.|::.|.|:|.|:
  Fly   571 APDDWENPHPCKEPEEVE-----------NIWSIMNTTWLSIGSLMGQGCDILPKAASTRLVTGM 624

Mouse   619 WWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEK 683
            ||||.|::::|||||||||||..|..:.|.||||||.|::|.||.:..|||..|||.|..:.::|
  Fly   625 WWFFALMMLNSYTANLAAFLTNSRQANSINSAEDLAAQSKIKYGAMAGGSTMGFFRDSNFSTYQK 689

Mouse   684 MWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGI 748
            |||.|:||.||||.:|.:||:.||:|.|..||:|:|||..||..:|| ||.:::||.||.|.|||
  Fly   690 MWTAMESASPSVFTKTNDEGVERVQKGKNLYAFLMESTTLEYNVERK-CDLVQIGGWLDYKSYGI 753

Mouse   749 ATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWW---YDKGECGSKDSGSKDKTSALSLSNVAGVF 810
            |.|..|..|..::.|||||.|.|.|.:||.|||   :..|.|...|....| |..|.|.||.|||
  Fly   754 AMPFNSPYRKQISAAVLKLGELGQLAELKRKWWKEMHGGGNCEKSDEDGGD-TPELGLENVGGVF 817

Mouse   811 YILIGGLGL--AMLVALIEFCYKSRSESKRMKGFCLIPQQSINEA------------IRTSTLPR 861
            .:|  ||||  ||::...||.:       .:|...:..:.|:.||            |.|..:..
  Fly   818 LVL--GLGLLSAMVLGCTEFLW-------NVKSVAIEEKISLKEAFKSEALFAARIWITTKPVHT 873

Mouse   862 NSGAGASGGSGSGEN-------GRVVSQDFPKS--MQSIPCMSHSSGMPLGA 904
            :|.:|:|..|.|..:       .:.:|....||  .|.:....||....:|:
  Fly   874 SSESGSSNSSSSSSSRSKHSFKSQGLSMKSLKSSGYQDVEASVHSKLKKIGS 925

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 94/386 (24%)
ANF_receptor 37..372 CDD:279440 87/349 (25%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 174/393 (44%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 133/289 (46%)
Glutamate binding. {ECO:0000250} 668..669 1/1 (100%)
PDZ-binding 904..907 0/2 (0%)
clumsyNP_001036373.1 PBP1_iGluR_Kainate 26..396 CDD:107377 92/377 (24%)
ANF_receptor 39..379 CDD:279440 87/347 (25%)
PBP2_iGluR_Kainate 414..787 CDD:270432 173/385 (45%)
Lig_chan 548..812 CDD:278489 126/277 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111336236
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.