DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and GluRIIB

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_523485.3 Gene:GluRIIB FlyBaseID:FBgn0020429 Length:913 Species:Drosophila melanogaster

Alignment Length:872 Identity:247/873 (28%)
Similarity:409/873 (47%) Gaps:100/873 (11%)


Mouse    25 IQIGGLFPNQQSQEHAAFRFALSQLT--EPPKLLPQID-IVNISDSFEMTYRFCSQFSKGVYAIF 86
            |:||.:|.:.:.:...||..||.::.  .|...|..|. .|.:.||..:....|.....||.|||
  Fly    25 IKIGAIFFDTEMKLADAFSAALEEVNAINPALKLDAIKRYVTVDDSIVLQDISCDLIGSGVAAIF 89

Mouse    87 GFYERRT---VNMLTSFCGALHVCFITPSFPVDTSN------QFVLQLRPE---LQEALISII-- 137
            |...:..   |.:|.:..|..|:.|   .:....||      |..:.:.|.   |..|...|:  
  Fly    90 GPSSKTNSDIVEVLCNMTGIPHLQF---DWHPQQSNRERMNHQLTVNVAPMELFLSAAFSDILAS 151

Mouse   138 DHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEEG--YRMLFQDLEKKKERLV 200
            ..:.|::|...|:....|..||.:|   |.|......:. :...|.|  ||:|::.:...:|:.|
  Fly   152 KTFDWKSFTIAYERSSHLIRLQHIL---AWKQLHKAGIK-MQEFERGDDYRILWKRINNAREKFV 212

Mouse   201 VVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAR 265
            ::||.|:.|..::...:.....|...|..|.||   |..|       :.:.||...::|..:.|.
  Fly   213 LLDCPSDILVDVINASIGYNMTGSFNHLFLTNL---DTHL-------SGIDGFYSRDFTVAVAAV 267

Mouse   266 IMQQWRTSDARDH-----TRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLA 325
            .::.:......|.     ..||.:.....|.|.||.:.:...|.       ::||:|  .|..:.
  Fly   268 RIRTYVPPPVHDEIDVFDNSVDTRFSSLGSQLVYDSIVLFYNAL-------LEISQR--PGFYIP 323

Mouse   326 NPAVP---WGQGIDIQRALQQVR-------FEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIG 380
            |.:..   |..|..:...::|:.       |:  |..:|.|..|:|.::.|.|.....|.:..| 
  Fly   324 NFSCGRGFWQPGPRLVEQMKQITPKMVKPPFK--TQRLQINADGQREDFNLEVYNPIIDRVTHI- 385

Mouse   381 YWNEDDKFVPAATDAQAGGDNSS-------VQNR--------TYIVTTILEDPYVMLKKNAN--Q 428
             ||::.:.|    |.:...:||:       :||:        .|.|.|.:..||...::...  .
  Fly   386 -WNKEFQLV----DFEKLRENSTQALKQKRLQNKEDFSQKPIRYTVATRVGKPYFSWREEPEGVH 445

Mouse   429 FEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPL 493
            :|||:|:|||.|:|...:|:...:.:..|.|.|.|||:.|.:|..|:|::.:|:...|.:.:..|
  Fly   446 YEGNERFEGYAVDLIYMLAQECKFDFNFEPVRDNKYGSYDANTDEWDGIIRQLIDNNAQIGICDL 510

Mouse   494 TITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVS 558
            |||..|..|:||:.|||.|||||:..|....|..:::||:|...|:|:.::.|.:..:..|....
  Fly   511 TITQARRSVVDFTVPFMQLGISILSYKEPPPKADIYAFLNPYNAEVWLFVMIAMMITAFALIFTG 575

Mouse   559 RFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFT 623
            |...|||........|:.   ::.|.:.:.|:||..||:.:.||||:.||.|..|::...||.|.
  Fly   576 RIDQYEWDQPVENVNREM---ERQNIWHLSNALWLVLGSMLNQGCDLLPRGLPMRLLTAFWWIFA 637

Mouse   624 LIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYM 688
            |:|..:|.|.||||:|..::...|.|..||..|.::.:||:..|:|..:|..|........|..|
  Fly   638 LLISQTYIAKLAAFITSSKIAGDIGSLHDLVDQNKVQFGTIRGGATSVYFSESNDTDNRMAWNKM 702

Mouse   689 KSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKG 753
            .|.:|..|.:..|||:.||:.|||.||:|:|:|..:|..||. |:..::|.:...|.||||.|..
  Fly   703 LSFKPDAFTKNNEEGVDRVKLSKGTYAFLMETTNLQYYVQRN-CELTQIGESFGEKHYGIAVPLN 766

Mouse   754 SALRGPVNLAVLKLSEQGVLDKLKSKWW-YDKGECGSK----DSGSKDKTSALSLSNVAGVFYIL 813
            :..|..:::.:|:|||:|.|.||::||: .::..|.|.    |.|..|      :.:|.|:|.:|
  Fly   767 ADFRSNLSVGILRLSERGELFKLRNKWFNSNESTCDSNVPTIDDGQFD------MDSVGGLFVVL 825

Mouse   814 IGGLGLAMLVALIEFCYKSRSESKRMK 840
            |.|:.:.:::.:.||.:..:..|.:.|
  Fly   826 IVGVVVGLVIGVAEFLWHVQRISVKEK 852

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 91/397 (23%)
ANF_receptor 37..372 CDD:279440 84/369 (23%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 135/392 (34%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 97/284 (34%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
GluRIIBNP_523485.3 PBP1_iGluR_Kainate 26..393 CDD:107377 91/397 (23%)
ANF_receptor 41..378 CDD:279440 84/365 (23%)
PBP2_iGluR_Kainate 422..795 CDD:270432 134/377 (36%)
Lig_chan 555..822 CDD:278489 93/277 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111336209
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.