DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and GluRIIA

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_523484.2 Gene:GluRIIA FlyBaseID:FBgn0004620 Length:907 Species:Drosophila melanogaster

Alignment Length:942 Identity:273/943 (29%)
Similarity:465/943 (49%) Gaps:114/943 (12%)


Mouse     4 IFAF-FCTGFLGAVV--GANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNI- 64
            |:|| ...|||..::  |.:..|.|.:|.:|...:.:...:|..|..::..  ....::..|.| 
  Fly     8 IYAFIIIIGFLEGIIALGGDDRNEITVGAIFYENEKEIELSFDQAFREVNN--MKFSELRFVTIK 70

Mouse    65 -----SDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDT------S 118
                 :|||.:....|...|.||.||||...:...:::.....|..:..|.....::.      :
  Fly    71 RYMPTNDSFLLQQITCELISNGVAAIFGPSSKAASDIVAQIANATGIPHIEYDLKLEATRQEQLN 135

Mouse   119 NQFVLQLRPE---LQEALISII-DHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILT 179
            :|..:.:.|.   |..|...|| .:|:|:||..||:...||:.||.:::..|..:..|...|:..
  Fly   136 HQMSINVAPSLSVLSRAYFEIIKSNYEWRTFTLIYETPEGLARLQDLMNIQALNSDYVKLRNLAD 200

Mouse   180 TTEEGYRMLFQDLEKK-KERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANL-----GFMDI 238
            ..:: ||:|:::.::. .|:.:::|||.:.|..:|...:..:..|...::.|.:|     |..||
  Fly   201 YADD-YRILWKETDETFHEQRIILDCEPKTLKELLKVSIDFKLQGPFRNWFLTHLDTHNSGLRDI 264

Mouse   239 DLNKFKESGANVTGFQLVNYTDTIPARIMQQWRTSDARDHTRVDWKRPKYT--SALTYDGVKVMA 301
            ....||   ||:|..:|    ..:.|...::.:|.    .|:||......|  ..|.||.|.:  
  Fly   265 YNEDFK---ANITSVRL----KVVDANPFERKKTR----LTKVDQILGNQTMLPILIYDAVVL-- 316

Mouse   302 EAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGL-----TGNVQFNEKGRR 361
              |.|..|..|...:..:..:.....:.||..|..|...::.:..:.:     |.|::.:|.|:|
  Fly   317 --FASSARNVIAAMQPFHPPNRHCGSSSPWMLGAFIVNEMKTISEDDVEPHFKTENMKLDEYGQR 379

Mouse   362 TNYTLHV----------IEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILE 416
            .::.|.:          :....:||:|        :.:....::.....:.|.|.:.|.|.|..|
  Fly   380 IHFNLEIYKPTVNEPMMVWTPDNGIKK--------RLLNLELESAGTTQDFSEQRKVYTVVTHYE 436

Mouse   417 DPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVS-DGKYGARDPDTKAWNGMVGE 480
            :||.|:|::...|.|.::||||.|:|.:::::.:.:.|...||: :|||   :|:||.|:|::.:
  Fly   437 EPYFMMKEDHENFRGREKYEGYAVDLISKLSELMEFDYEFMIVNGNGKY---NPETKQWDGIIRK 498

Mouse   481 LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVF 545
            |:...|.:.|..||||.:|..|:||:.|||.|||||:..|........|:||:|.|.|:|:.::|
  Fly   499 LIDHHAQIGVCDLTITQMRRSVVDFTVPFMQLGISILHYKSPPEPKNQFAFLEPFAVEVWIYMIF 563

Mouse   546 AYIGVSVVLFLVSRFSPYEW--------HSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQG 602
            |.:.:::....::|.|..||        ..:|.|           |.:.:.||.|..:|:.||||
  Fly   564 AQLIMTLAFVFIARLSYREWLPPNPAIQDPDELE-----------NIWNVNNSTWLMVGSIMQQG 617

Mouse   603 CDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAG 667
            |||.||....||:.|:||||.|:::|:||||||||||..:..|.|:|.:||.:|.::.:|::..|
  Fly   618 CDILPRGPHMRILTGMWWFFALMMLSTYTANLAAFLTSNKWQSSIKSLQDLIEQDKVHFGSMRGG 682

Mouse   668 STKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPC 732
            ||..||..|....:::.|..||...||.|..|.:||:.||||.||.||:|:|:|...|..:|. |
  Fly   683 STSLFFSESNDTDYQRAWNQMKDFNPSAFTSTNKEGVARVRKEKGGYAFLMETTSLTYNIERN-C 746

Mouse   733 DTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKG-ECGSKDSGSKD 796
            |..::|..:..|.||:|.|.||..|..:::::|:|||:|.|.|:|:|||.:.. .|.|......|
  Fly   747 DLTQIGEQIGEKHYGLAVPLGSDYRTNLSVSILQLSERGELQKMKNKWWKNHNVTCDSYHEVDGD 811

Mouse   797 KTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSI----------- 850
            :   ||:..:.|||.:|.||:.:.:::.:.||.:..::.:...:   :.|.|:.           
  Fly   812 E---LSIIELGGVFLVLAGGVLIGVILGIFEFLWNVQNVAVEER---VTPWQAFKAELIFALKFW 870

Mouse   851 --NEAIRTSTLPRNSGAGASGGS--GSGENGR 878
              .:.:|.|:....|.:..|.||  .|.|..|
  Fly   871 VRKKPMRISSSSDKSSSRRSSGSRRSSKEKSR 902

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 86/402 (21%)
ANF_receptor 37..372 CDD:279440 81/374 (22%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 152/391 (39%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 111/288 (39%)
Glutamate binding. {ECO:0000250} 668..669 1/1 (100%)
PDZ-binding 904..907
GluRIIANP_523484.2 PBP1_iGluR_Kainate 33..404 CDD:107377 84/389 (22%)
ANF_receptor 46..386 CDD:279440 81/358 (23%)
PBP2_iGluR_Kainate 426..796 CDD:270432 152/385 (39%)
Lig_chan 556..828 CDD:278489 110/287 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111336158
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.