DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir25a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001260049.1 Gene:Ir25a FlyBaseID:FBgn0031634 Length:947 Species:Drosophila melanogaster

Alignment Length:986 Identity:255/987 (26%)
Similarity:419/987 (42%) Gaps:269/987 (27%)


Mouse    11 GFLGAV------VGANFPNNIQIGGLFPNQQSQEHAA-------------FRFALSQLTEPPKLL 56
            |||..:      :.|....||.:  ||.|:...|.||             .|:.||         
  Fly    16 GFLSLLSSFSLEIAAQTTQNINV--LFINEVDNEPAAKAVEVVLTYLKKNIRYGLS--------- 69

Mouse    57 PQIDIV--NISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNML-------------TSFCGALHV 106
            .|:|.:  |.||:..:....|::::..:      .:::|.:::             .||..||.:
  Fly    70 VQLDSIEANKSDAKVLLEAICNKYATSI------EKKQTPHLILDTTKSGIASETVKSFTQALGL 128

Mouse   107 CFITPSF----------PVDTSNQ-FVLQLRPE---LQEALISIIDHYKWQTFVYIYDAD----- 152
            ..|:.|:          .:|.:.| ::||:.|.   :.||:.||:.|........:||..     
  Fly   129 PTISASYGQQGDLRQWRDLDEAKQKYLLQVMPPADIIPEAIRSIVIHMNITNAAILYDDSFVMDH 193

Mouse   153 RGLSVLQRVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCES-------ERLN 210
            :..|:||.:     :....:||:     .::|.|    :.|::.|:|..:|..:       :.:.
  Fly   194 KYKSLLQNI-----QTRHVITAI-----AKDGKR----EREEQIEKLRNLDINNFFILGTLQSIR 244

Mouse   211 AILGQI--VKLEKNGIGYHYILANLG--------------------------------------- 234
            .:|..:  ...|:| ..:|.|..|.|                                       
  Fly   245 MVLESVKPAYFERN-FAWHAITQNEGEISSQRDNATIMFMKPMAYTQYRDRLGLLRTTYNLNEEP 308

Mouse   235 ------FMDIDLNKF---KE---SGANVTGFQLVNYTDTIPARIMQQWRTSDARDH-TRVDWKRP 286
                  :.|:.|..|   ||   |||.....:.:|..|.......|  |..|.||: |::    .
  Fly   309 QLSSAFYFDLALRSFLTIKEMLQSGAWPKDMEYLNCDDFQGGNTPQ--RNLDLRDYFTKI----T 367

Mouse   287 KYTSALTYDGVKVMAEAF--QSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGL 349
            :.||..|:|.|....:.|  .|..:..:||:                         :.|:|    
  Fly   368 EPTSYGTFDLVTQSTQPFNGHSFMKFEMDIN-------------------------VLQIR---- 403

Mouse   350 TGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRT----YI 410
             |....|.|                   .||.|      :..........|...::|.|    |.
  Fly   404 -GGSSVNSK-------------------SIGKW------ISGLNSELIVKDEEQMKNLTADTVYR 442

Mouse   411 VTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWN 475
            :.|:::.|::|..:.|.:     .|:|||::|..|||..|.:.|.::.|.|||:|..| :...||
  Fly   443 IFTVVQAPFIMRDETAPK-----GYKGYCIDLINEIAAIVHFDYTIQEVEDGKFGNMD-ENGQWN 501

Mouse   476 GMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSL-GISIMIKKPQKSKPGVFSFLDPLAYEI 539
            |:|.:|:..:||:.:..:::...||.||||:.|:..| ||:||:::| .|...:|.||..|...:
  Fly   502 GIVKKLMDKQADIGLGSMSVMAEREIVIDFTVPYYDLVGITIMMQRP-SSPSSLFKFLTVLETNV 565

Mouse   540 WMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCD 604
            |:||:.||...|.::::..|:|||.:.:.. |:.:|   .::..||.:...|||.:.:...||..
  Fly   566 WLCILAAYFFTSFLMWIFDRWSPYSYQNNR-EKYKD---DEEKREFNLKECLWFCMTSLTPQGGG 626

Mouse   605 ISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGST 669
            .:|::||||:|...||.|..|||:||||||||||||.|:.:|:||.:|||||.:|.|..|...|.
  Fly   627 EAPKNLSGRLVAATWWLFGFIIIASYTANLAAFLTVSRLDTPVESLDDLAKQYKILYAPLNGSSA 691

Mouse   670 KEFF--------------------------RRSKIAVFE--------KMWTYMKSAE-PSVFVRT 699
            ..:|                          .|||:||::        |||..|:.|: |:    |
  Fly   692 MTYFERMSNIEQMFYEIWKDLSLNDSLTAVERSKLAVWDYPVSDKYTKMWQAMQEAKLPA----T 752

Mouse   700 TEEGMIRVRKSKGK--YAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNL 762
            .:|.:.|||.|...  :|:|.::|...|: |...||...||.....|.|.||..:||.|:...|.
  Fly   753 LDEAVARVRNSTAATGFAFLGDATDIRYL-QLTNCDLQVVGEEFSRKPYAIAVQQGSHLKDQFNN 816

Mouse   763 AVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIE 827
            |:|.|..:..|:|||.||| ...|..:|....:|::..:|:.|:.|||.::..|:|:|.:..:.|
  Fly   817 AILTLLNKRQLEKLKEKWW-KNDEALAKCDKPEDQSDGISIQNIGGVFIVIFVGIGMACITLVFE 880

Mouse   828 F-CYKSRSESK 837
            : .|:.|...:
  Fly   881 YWWYRYRKNPR 891

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 85/473 (18%)
ANF_receptor 37..372 CDD:279440 79/445 (18%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 150/423 (35%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 110/316 (35%)
Glutamate binding. {ECO:0000250} 668..669 1/1 (100%)
PDZ-binding 904..907
Ir25aNP_001260049.1 PBP1_iGluR_AMPA_Like 40..426 CDD:107378 84/477 (18%)
PBP2_iGluR_putative 438..836 CDD:270435 147/415 (35%)
Lig_chan 565..870 CDD:278489 110/315 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111313733
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.