DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and GluRIIC

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_608557.4 Gene:GluRIIC FlyBaseID:FBgn0046113 Length:940 Species:Drosophila melanogaster

Alignment Length:957 Identity:267/958 (28%)
Similarity:429/958 (45%) Gaps:122/958 (13%)


Mouse    13 LGAVVGANF-----PNNIQIGGLFPNQQSQEHAAFRFALSQLTEPP-----KLLPQIDIVNISD- 66
            ||.:..|.|     ...|.||..|.:.:.:....|...::.:..|.     :..|.|..:...| 
  Fly     8 LGCMWSAFFMCRSRGQQINIGAFFYDDELELEKEFMTVVNAINGPESEQTMRFYPLIKRLKPEDG 72

Mouse    67 SFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTS----------NQF 121
            |..|....|.....||.||||...:...:::...|.:..:    |....|.|          :|.
  Fly    73 SVTMQEHACDLIDNGVAAIFGPSSKAASDIVALVCNSTGI----PHIEFDISDEGIQAEKPNHQM 133

Mouse   122 VLQLRPE---LQEALISIIDHYKWQTFVYIYDAD--RGLSVLQRVLDTAAEKNWQVTAVNILTTT 181
            .|.|.|.   |.:|...|:.::.|:.|..:||||  |..:.||.:|......| .|..|... ..
  Fly   134 TLNLYPAQAILSKAYADIVQNFGWRKFTIVYDADDARAAARLQDLLQLREVHN-DVVRVRKF-HK 196

Mouse   182 EEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKF--- 243
            ::.:|::::.:  :.||.||:|||...|..:|....:....|...|..|.||......|.:.   
  Fly   197 DDDFRVMWKSI--RGERRVVLDCEPNMLVELLNSSTEFGLTGQYNHIFLTNLETYTDHLEELAAD 259

Mouse   244 -KESGANVTGFQLVNYTDTIPARIMQQWRTSDARDHTRVDWKRPKYT--SALTYDGVKVMAEAFQ 305
             :....|:|..:|:...|..|..:...:.|.  ||:...:...|..|  ..|.:|.:::.|::::
  Fly   260 NETFAVNITAARLLVNPDPPPYSLPYGYVTQ--RDNIVYESSDPPRTLIHDLIHDALQLFAQSWR 322

Mouse   306 S---LRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQ------QVRFEGLTGNVQFNEKGRR 361
            :   ....|:.:.|  ...|..|:....|..|..:.|.::      ...|.  |..:||:|.|:|
  Fly   323 NASFFYPDRMVVPR--ITCDFAASGGRTWAMGRYLARLMKGTSGVNNTNFR--TSILQFDEDGQR 383

Mouse   362 TNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYVMLKKNA 426
            ..:.:.|.: ..||| .|..|:      |.....|...|..:.:...|.|.|.:..||....:.|
  Fly   384 ITFNIEVYD-PLDGI-GIAIWD------PRGQITQLNVDVKAQKKMIYRVATRIGPPYFSYNETA 440

Mouse   427 NQFE--GNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVA 489
            .:..  ||..|:||.|:|...||:|||:.|....|:|.:||..|.:||.|||::||::...|.:.
  Fly   441 RELNLTGNALYQGYAVDLIDAIARHVGFEYVFVPVADQQYGKLDKETKQWNGIIGEIINNDAHMG 505

Mouse   490 VAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVL 554
            :..||||..|:..:||:.|||.||:||:..|....:..:.::|.|...|:|:.|:   |.|.|:.
  Fly   506 ICDLTITQARKTAVDFTVPFMQLGVSILAYKSPHVEKTLDAYLAPFGGEVWIWIL---ISVFVMT 567

Mouse   555 FL---VSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVG 616
            ||   |:|.|..:|.:.. ...||....:  |::.|.|:.|.::.:.|..||||.|||...|:..
  Fly   568 FLKTIVARISKMDWENPH-PCNRDPEVLE--NQWRIHNTGWLTVASIMTAGCDILPRSPQVRMFE 629

Mouse   617 GVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVF 681
            ..||.|.:||.:|||||||||||..:|...|.:.:||:.|.::.:||:..|||......|...|:
  Fly   630 ATWWIFAIIIANSYTANLAAFLTSSKMEGSIANLKDLSAQKKVKFGTIYGGSTYNLLADSNETVY 694

Mouse   682 EKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGY 746
            ...:..|.:.:||.:.:...||:.||||::|.|.:|:|:|..|| .:.:.||...||.....|.|
  Fly   695 RLAFNLMNNDDPSAYTKDNLEGVDRVRKNRGDYMFLMETTTLEY-HREQNCDLRSVGEKFGEKHY 758

Mouse   747 GIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYD-KGECGSKDSGSKDKTSALSLSNVAGVF 810
            .||.|.|:..|..:::|:|||||:|.|..||.|||.: ...|  .:....|.|..::...:.|:|
  Fly   759 AIAVPFGAEYRSNLSVAILKLSERGELYDLKQKWWKNPNASC--FEEPDPDATPDMTFEELRGIF 821

Mouse   811 YILIGGLGLAMLVALIEF-------------CYKSRSESKRMKGFCL------------------ 844
            |.|..|:.:|.|:.:.||             .:|...:.:.....|:                  
  Fly   822 YTLYAGILIAFLIGITEFLVYVQQVALEERLTFKDAFKKEIRFVLCVWNNRKPIVAGTPISSVRT 886

Mouse   845 IPQQSINEAI-------------RTSTLPRNSGAGASGGSGSGENGR 878
            .|::|:::::             |:|...|....|:...|||...||
  Fly   887 TPRRSLDKSLDRTPKSSRRVVIGRSSEEMREMAQGSGSSSGSNNAGR 933

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 90/399 (23%)
ANF_receptor 37..372 CDD:279440 82/371 (22%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 144/387 (37%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 103/283 (36%)
Glutamate binding. {ECO:0000250} 668..669 1/1 (100%)
PDZ-binding 904..907
GluRIICNP_608557.4 PBP1_iGluR_Kainate 26..404 CDD:107377 90/400 (23%)
Periplasmic_Binding_Protein_Type_1 <279..363 CDD:299141 16/88 (18%)
PBP2_iGluR_Kainate 423..794 CDD:270432 144/378 (38%)
Lig_chan 554..828 CDD:278489 103/283 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111336185
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.