DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir21a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001097043.1 Gene:Ir21a FlyBaseID:FBgn0031209 Length:842 Species:Drosophila melanogaster

Alignment Length:862 Identity:162/863 (19%)
Similarity:294/863 (34%) Gaps:233/863 (27%)


Mouse   140 YKWQTFV------YIYDADRGLS----VLQRVLDTAAEKNWQVTAVNILT-TTEEGYRM------ 187
            |.|...|      :..:.||..|    .:.|.|....:.|.::..|.:.. ..|..:|.      
  Fly     3 YYWVALVLFTAQAFSIEGDRSASYQEKCISRRLINHYQLNKEIFGVGMCDGNNENEFRQKRRIVP 67

Mouse   188 LFQDLEKKKERLV-----VVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNK----- 242
            .||...:.:..|:     |.....|:.|:::|.:     |.|...|           |||     
  Fly    68 TFQGNPRPRGELLASKFHVNSYNFEQTNSLVGLV-----NKIAQEY-----------LNKCPPVI 116

Mouse   243 ----FKESGANVTGFQLVNYTDTIP-----ARIMQQWRTSDARDHTRVDWKRPKYTSALTYDGVK 298
                |.|..   .|..|.|...|||     ..|...:...:.|..:.:|.....|...|:     
  Fly   117 YYDSFVEKS---DGLILENLFKTIPITFYHGEINADYEAKNKRFTSHIDCNCKSYILFLS----- 173

Mouse   299 VMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNV---------Q 354
                  ..|..::| :..:..:...|.:.:..|        .|:......|:.|:         .
  Fly   174 ------DPLMTRKI-LGPQTESRVVLVSRSTQW--------RLRDFLSSELSSNIVNLLVIGESL 223

Mouse   355 FNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPY 419
            ..:..|...|.|:..::..||:                      |.|:.|...::| ...|..|:
  Fly   224 MADPMRERPYVLYTHKLYADGL----------------------GSNTPVVLTSWI-KGALSRPH 265

Mouse   420 VMLKKNANQF----------------------------EGNDRYEGYCVELAAEIAKHVGYSYRL 456
            :.|..:..||                            .|..|::|....|...|:|.:.:|..:
  Fly   266 INLFPSKFQFGFAGHRFQISAANQPPFIFRIRTLDSSGMGQLRWDGVEFRLLTMISKRLNFSIDI 330

Mouse   457 EIVSDGKYGARDPDTKAWNGMVG----ELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGIS-- 515
                     ...|......|:|.    :::....|:.::.:.||  :|.::|.:   ||:|.|  
  Fly   331 ---------TETPTRSNTRGVVDTIQEQIIERTVDIGMSGIYIT--QERLMDSA---MSVGHSPD 381

Mouse   516 --IMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTT 578
              ..|....|:.|...:.:.|..:.:|:.::..|:|....:....|.                |.
  Fly   382 CAAFITLASKALPKYRAIMGPFQWPVWVALICVYLGGIFPIVFTDRL----------------TL 430

Mouse   579 SDQSNEFG-IFNSLWFSLG------AFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAA 636
            |.....:| :.|..|:..|      :|..:....:.|..|.|::.|.:|.||:||.|.||.::.|
  Fly   431 SHLMGNWGEVENMFWYVFGMFTNAFSFTGKYSWSNTRKNSTRLLIGAYWLFTIIITSCYTGSIIA 495

Mouse   637 FLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTE 701
            |:|:......::|..||. ......|||..|..:.:|:.|......:::..|:      ||.:.:
  Fly   496 FVTLPAFPDTVDSVLDLL-GLFFRVGTLNNGGWETWFQNSTHIPTSRLYKKME------FVGSVD 553

Mouse   702 EGMIRVRKS-KGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKG-------------YGIATPK 752
            ||:..|.:| ...||:|......||:.|....|.     |:..:.             .|...|:
  Fly   554 EGIGNVTQSFFWNYAFLGSKAQLEYLVQSNFSDE-----NISRRSALHLSEECFALFQIGFLFPR 613

Mouse   753 GSALRGPVNLAVLKLSEQGVLDKLKSK--WWYDKGECGSKDSGSKDKT--------SALSLSNVA 807
            .|..:..::..:|...:.|::.|:.::  |...:...|.....|...:        ..|:.::..
  Fly   614 ESVYKIKIDSMILLAQQSGLIAKINNEVSWVMQRSSSGRLLQASSSNSLREIIQEERQLTTADTE 678

Mouse   808 GVFYILIGG--LGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASGG 870
            |:|.::..|  ||...||            |:.:.|.....:|.|..:.:::.   :|.:.||.|
  Fly   679 GMFLLMALGYFLGATALV------------SEIVGGITNKCRQIIKRSRKSAA---SSWSSASSG 728

Mouse   871 SGSGENGRVVSQDFPKS 887
            |....|...:|.|..|:
  Fly   729 SMLRTNAEQLSHDKRKA 745

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 50/294 (17%)
ANF_receptor 37..372 CDD:279440 48/277 (17%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 86/440 (20%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 63/312 (20%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir21aNP_001097043.1 Periplasmic_Binding_Protein_Type_2 289..583 CDD:304360 71/331 (21%)
Lig_chan 407..662 CDD:278489 59/283 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.