DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir11a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_572795.2 Gene:Ir11a FlyBaseID:FBgn0030385 Length:642 Species:Drosophila melanogaster

Alignment Length:798 Identity:141/799 (18%)
Similarity:253/799 (32%) Gaps:296/799 (37%)


Mouse    93 TVNMLTSFCGALHVCFITPSFPVDTS-------NQFVLQLRPELQEALISIIDHYKWQTFVYIYD 150
            |.|.:.:....|.|..|....|.:.|       :|.:..|.|||     |::.|           
  Fly    59 TRNYIANRINTLVVREICVECPYELSERQRQLVDQILASLAPEL-----SVLLH----------- 107

Mouse   151 ADRGLSVLQRVLDTAAEKNWQVT--AVNILTTTEEGYRMLFQD--LEKKKERLVVV-DCESER-L 209
              :|         ||.|..|:.|  .||. .|...|...:|.|  ||::...:||| :.:|.: :
  Fly   108 --KG---------TAEETTWEYTLFVVND-HTAFTGQVFIFPDELLEREFFCIVVVSEIQSRQFV 160

Mouse   210 NAILGQIVKLEKNGIGYHY----ILANLGFMDIDLNKFKESGANVT-GFQL--VNYTDTIPARIM 267
            ...:|.||   |:.:..|:    ::|.|....:....:|...||.| |..:  :|:.|.|..:..
  Fly   161 RQTVGSIV---KSNLQMHFVNVVVVAQLEDGTVGTYSYKLFKANCTPGITVRQINHFDRITGKPQ 222

Mouse   268 QQWRTSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWG 332
            |.                              |.:.:.         .|.|:.|||      |:.
  Fly   223 QS------------------------------MPDLYP---------VRNGHLGDC------PFN 242

Mouse   333 QGIDIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQA 397
            .|                          ..:...|:|..:|             |..|.|:    
  Fly   243 VG--------------------------AAHMPPHLIYKRH-------------KDPPPAS---- 264

Mouse   398 GGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDG 462
               |.|:.                    |....|.|      .:|...:||  ...:|:::    
  Fly   265 ---NVSIP--------------------AEDLAGID------WDLLQLLAK--ALKFRIQL---- 294

Mouse   463 KYGARDPDTKAWNGMVG----ELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQ- 522
             |..::|......|.|.    :|..|...:|:..|:.:..|..:...|..:......:::::.: 
  Fly   295 -YMPQEPSQIFGEGNVSGCFRQLADGTVSIAIGGLSGSDKRRSLFSKSTVYHQSNFVMVVRRDRY 358

Mouse   523 --KSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEF 585
              :..|.:.    |...::|        ||.:|:.|::..|                |....:..
  Fly   359 LGRLGPLIL----PFRGKLW--------GVIIVILLLAVLS----------------TCWLRSRL 395

Mouse   586 GIFNSLWFSLGAFMQQGCDISPRSLSG----RIVGGVWWFFTLIIISSYTANLAAFLTVERMVSP 646
            |:.:.:...|...:  |..|....|.|    |.:...|...||::..:|.|.|...|.:.|. .|
  Fly   396 GLSHPIEDLLTVIV--GNPIPDHRLPGKGFLRYLLASWMLLTLVLRCAYQARLFDVLRLSRH-RP 457

Mouse   647 IESAEDLAKQTEIAYGTLEAGSTKEFF-----------------RRSKIAVFEKMWT-------- 686
            :  .:||:...:..| |:.|....:|:                 |..:.|..|::.|        
  Fly   458 L--PKDLSGLIKDNY-TMVANGYHDFYPLELTCRQPLDFSARFERVQRAAPDERLTTIALISNLA 519

Mouse   687 YMKSAEPSV----FVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYG 747
            |.....|::    |||            :..|.|.|.                            
  Fly   520 YWNHKHPNISRLTFVR------------QPIYMYHLV---------------------------- 544

Mouse   748 IATPKGSALRGPVNLAVLKLSEQGVLDKLKSKW--WYDKGECGSKDSGSKDKTSALSLSN----V 806
            |..|:...||..::..:.:|...||:..::.::  :.:|.:..|.|.....:.:. |:.|    :
  Fly   545 IYFPRRFFLRPAIDRKIKQLLSAGVMAHIERRYMQYENKRKVASNDPVLLRRITK-SIMNGAYRI 608

Mouse   807 AGVFYILIGGLGLAMLVA 824
            .|:..:|..|:.:..|:|
  Fly   609 HGLVIVLATGMFILELLA 626

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 60/316 (19%)
ANF_receptor 37..372 CDD:279440 58/299 (19%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 68/423 (16%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 56/318 (18%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir11aNP_572795.2 Periplasmic_Binding_Protein_Type_2 306..>356 CDD:304360 8/50 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.