DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir31a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001260346.1 Gene:Ir31a FlyBaseID:FBgn0051718 Length:648 Species:Drosophila melanogaster

Alignment Length:575 Identity:109/576 (19%)
Similarity:206/576 (36%) Gaps:111/576 (19%)


Mouse   331 WGQGIDIQRALQ-QVRFEGLTGNVQF-NEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAAT 393
            ||..:::|.... .:.:.|....:.: ||..              ||   ..||           
  Fly   121 WGVDLEVQSLFPLNLNYVGPNAQITYVNETA--------------DG---YAYW----------- 157

Mouse   394 DAQAGGDNSSVQNRTYIVTTILEDP--------YVMLKKNANQFEG----------------NDR 434
            |..:.|.:........::.|::.|.        ::.......||.|                |::
  Fly   158 DIHSKGRHLKSNLEINLIATLINDTLNIARDIFHLQSIDFRGQFNGLTLRGASVIDKEDIISNEQ 222

Mouse   435 YEGYCVELA--AEIAKHVGYSYRLEIVSDGKYG--ARDPDTKAWNGMVGELVY----------GR 485
            .|.......  |.:|..:.|.|.|..:...::.  ....:::.|.|.:|...:          ..
  Fly   223 IESILSRPTKDAGVAAFIKYHYELLGLLRERFNFTVNFRNSRGWAGRLGNTTFRLGLLGIVMRNE 287

Mouse   486 ADVAVAPLTITLVREEVID-------FSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWM-C 542
            ||:|.:.....:.|....|       |...|:....|.:   ....|.|  :||.|.:..:|: |
  Fly   288 ADIAASGAFNRINRFAEFDTIHQSWKFETAFLYRYTSDL---DTHGKSG--NFLSPFSDRVWLFC 347

Mouse   543 IVFAYIGVSVVLFLVSRFSPYE-----WHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQG 602
            ::  .:|...:::::.....|:     .:|::.|. .:|.:|....:......:..:.||..|||
  Fly   348 LL--TLGAFSIIWVLFEIIDYKILRIRVNSQKLEH-LNQKSSVICIKTTCIERILQTFGACCQQG 409

Mouse   603 CDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAG 667
            .|.:|...|.|.:....:.|:|::.:.||:::...|.......|....|..|...:|::.  :.|
  Fly   410 LDPNPVDRSVRFLVMTLFLFSLVMYNYYTSSVVGGLLSSSDQGPSTVDEITASPLKISFE--DIG 472

Mouse   668 STKEFFR----RSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLE-----STMN 723
            ..|..||    ||...:.||..:..:|..........|:.:..::  .|.:|:..|     ..::
  Fly   473 YYKVLFRESQNRSITRLIEKKLSSSRSLNELPIFSHIEDAVPYLK--AGGFAFHCEVVDAYPVIS 535

Mouse   724 EYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECG 788
            ||.:..:.||..:|.|.::.:.......|.|........|:....|:|.::::..:....|..|.
  Fly   536 EYFDANEICDLREVSGLMEVEILNWILHKNSQYTEIFKTAMCNAQEKGFVERILRRRQIKKPACQ 600

Mouse   789 SKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMKGFC 843
            |..:     ...:|||.|...|.|||.|.|.::|:..:|..|......|    ||
  Fly   601 SLYT-----VYPVSLSGVLPGFVILICGFGASLLLLCLEKVYAHFGPRK----FC 646

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 10/60 (17%)
ANF_receptor 37..372 CDD:279440 6/43 (14%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 79/441 (18%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 62/294 (21%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir31aNP_001260346.1 Lig_chan 401..624 CDD:278489 54/232 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.