DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir8a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_727328.1 Gene:Ir8a FlyBaseID:FBgn0052704 Length:936 Species:Drosophila melanogaster

Alignment Length:886 Identity:212/887 (24%)
Similarity:362/887 (41%) Gaps:205/887 (23%)


Mouse   142 WQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNI-LTTTEEGYRMLFQDLEKKKERLVVVDCE 205
            |...|...:.|..::::.:.|| |...:.:|....: ||.:|:|.     |:::..|.|..|...
  Fly    25 WIEPVQRAEFDTDIAMVLKELD-ALRLDVKVDDTTLTLTRSEDGL-----DMQRFCEILSTVGAS 83

Mouse   206 S----------ERLNAILGQIVKLEKNGIGYHYILANL-GFMDIDLNKFKESGANVTGFQLVNYT 259
            :          |..|.:       ...||||..:...: .|:|:..:..::..||......:|..
  Fly    84 AVIDLTYSHWEEGYNLV-------RSLGIGYVRLERIMRPFLDMFGDFMRQKRANNVAMVFMNAR 141

Mouse   260 DTIPARIMQQ------WRT-------SDARDH--TRVDWKRPK------YTSALTYDGV--KVM- 300
            |.:.|  |||      :||       :|...|  .|:...||.      :..|...:|:  ||. 
  Fly   142 DAVEA--MQQMLVGYPFRTLIMDASQTDPGQHFLERIRSLRPAPTYIALFARAAAMNGIFEKVQK 204

Mouse   301 AEAFQ-----------------SLRRQ-----RIDISRRGNAGDCLANPAVPWGQGIDIQRALQQ 343
            |:.||                 ..|||     |..::.|..... :..|.:..|.|..:|||:..
  Fly   205 ADLFQRPLEWHFVFLDTRDRVFKYRRQAELCTRFTLNPRAICRS-MPMPDLYCGSGFTMQRAMLL 268

Mouse   344 VRFEGLTGNVQFNEKGRRTNYTLHVIE---------MKHDGIRKIGY-------WNE-------- 384
            .....|....|.:     ..|.|.:.:         ...|.:.|..|       |:.        
  Fly   269 NVLRSLINAAQVS-----PGYPLAIYQDCNATASSSEVSDPLEKDDYNWLDMVHWSNFLAYAPPL 328

Mouse   385 ---DDKF---VPAATDA---QAG------------------------GDNSSVQNRTYIVTTILE 416
               .|:|   ||..|.|   .||                        .:..|...|.:.:.|...
  Fly   329 PHIQDQFQSPVPGLTFAVNISAGYYSSEHEAKTDLAAWSSVGEMRLLNETISPARRFFRIGTAES 393

Mouse   417 DPYVMLKKNANQFE------GNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWN 475
            .|:..|::.....|      |...:||||::....:::.:.:.:.:.....|..|..: :...|:
  Fly   394 IPWSYLRREEGTGELIRDRSGLPIWEGYCIDFIIRLSQKLNFEFEIVAPEVGHMGELN-ELGEWD 457

Mouse   476 GMVGELVYGRADVAVAPLTITLVREEVIDFSKPFM-SLGISIMIKKPQKSKPGVFSFLDPLAYEI 539
            |:||:||.|..|.|:|.|.:...|||||||..|:. ..||||.|:||.: :..:|.|:..|..|:
  Fly   458 GVVGDLVRGETDFAIAALKMYSEREEVIDFLPPYYEQTGISIAIRKPVR-RTSLFKFMTVLRLEV 521

Mouse   540 WMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCD 604
            |:.||.|.:|.:::::.:.::|||.      .....|.......||.:..|.||:|.:|..||..
  Fly   522 WLSIVAALVGTAIMIWFMDKYSPYS------SRNNRQAYPYACREFTLRESFWFALTSFTPQGGG 580

Mouse   605 ISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGST 669
            .:|:::|||::...:|.|.:::::::|||||||||||||.:|::|.|.||:|:.|.|..::...|
  Fly   581 EAPKAISGRMLVAAYWLFVVLMLATFTANLAAFLTVERMQTPVQSLEQLARQSRINYTVVKDSDT 645

Mouse   670 KEFFRRSKIAV-----------------FEK--MWTY------------MKSAEPSVFVRTTEEG 703
            .::|...|.|.                 |:|  :|.|            :.|::|   |...:||
  Fly   646 HQYFVNMKFAEDTLYRMWKELALNASKDFKKFRIWDYPIKEQYGHILLAINSSQP---VADAKEG 707

Mouse   704 MIRV-RKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKL 767
            ...| ......||::.:|...:| |..:.|:..:||.....:.|.:|..:||.|...::.|:|:|
  Fly   708 FANVDAHENADYAFIHDSAEIKY-EITRNCNLTEVGEVFAEQPYAVAVQQGSHLGDELSYAILEL 771

Mouse   768 SEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKS 832
            .:....::||:|:|   .:....:....:....::|.::.|||...:.||.|||:...:|..|..
  Fly   772 QKDRFFEELKAKYW---NQSNLPNCPLSEDQEGITLESLGGVFIATLFGLVLAMMTLGMEVLYYK 833

Mouse   833 RSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASGGSGS 873
            :.:               |....|...|.|..:|:.|.|.:
  Fly   834 KKQ---------------NALEITQVRPVNDSSGSGGNSST 859

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 66/335 (20%)
ANF_receptor 37..372 CDD:279440 60/297 (20%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 121/420 (29%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 85/311 (27%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir8aNP_727328.1 PBP2_iGluR_putative 383..786 CDD:270435 121/418 (29%)
Lig_chan 520..818 CDD:278489 85/311 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.