DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and GluRIIE

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001036733.1 Gene:GluRIIE FlyBaseID:FBgn0051201 Length:897 Species:Drosophila melanogaster

Alignment Length:859 Identity:291/860 (34%)
Similarity:446/860 (52%) Gaps:86/860 (10%)


Mouse    17 VGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLL--PQIDI---------------VNI 64
            :..|:......|| :.|.||.|.........|.||...::  ..||:               ||.
  Fly    17 ISVNWAQYENFGG-YDNYQSLESVPIGLLTDQNTEQMNIVFDHAIDVANQEVGTSLTSLKEEVNY 80

Mouse    65 SDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRP-E 128
            .|:::...:.|.....|:..:||...|.|...|.|.|.|:.:..|. |:..:.:..|.|...| :
  Fly    81 GDAYQSYGKLCRMLETGIAGVFGPSSRHTAVHLMSICDAMDIPHIY-SYMSENAEGFNLHPHPAD 144

Mouse   129 LQEALISIIDHYKWQTFVYIYDADRGLSVLQRVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLE 193
            |.:||.|:|..:.|..|:::|::...|::|..:.....:....:|.:.........|:.:.:.:.
  Fly   145 LAKALYSLITEFNWTRFIFLYESAEYLNILNELTTMLGKSGTVITVLRYDMQLNGNYKQVLRRVR 209

Mouse   194 KKKERLVVVDCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNY 258
            |..:..:||...||.:...|.|..::......|.||:.||.|...||.::|.|.||:||.:|.:.
  Fly   210 KSVDNRIVVVGSSETMPEFLNQAQQVGIINEDYKYIIGNLDFHSFDLEEYKYSEANITGLRLFSP 274

Mouse   259 TDTIPARIMQQWRTSDARDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDC 323
            .......::.:......:|..|..........|||||.|::.|:..::|                
  Fly   275 EKMAVKELLMKLGYPTDQDEFRNGSCPITVEMALTYDAVQLFAQTLKNL---------------- 323

Mouse   324 LANPAVPWGQGIDIQRALQQVRFEG----------------LTGNVQFNEKGRRTNYTLHVIEMK 372
               |..|..|... ||. :.||.:|                |||.:.| |...|..|.|.|||::
  Fly   324 ---PFKPMPQNCS-QRT-ESVRDDGSSFKNYMRTLRLTDRLLTGPIYF-EGNVRKGYHLDVIELQ 382

Mouse   373 HDGIRKIGYWNEDDKFVP---AATDAQAGGDNSSVQNRTYIV-TTILEDPYVMLKKNANQFEGND 433
            ..||.|:|.|:||.::.|   |.|.||....::|:.|:|:|: .::...||..|.:...|.|||.
  Fly   383 PSGIVKVGTWDEDRQYRPQRLAPTTAQFDSVDNSLANKTFIILLSVPNKPYAQLVETYKQLEGNS 447

Mouse   434 RYEGYCVELAAEIAKHVGYSYRLEIVSDGK-YGARDPDTKAWNGMVGELVYGRADVAVAPLTITL 497
            :||||.|:|..|:|..:|:::  ..|:.|. ||:.:..|....||:.|::.||||:|:..||||.
  Fly   448 QYEGYGVDLIKELADKLGFNF--TFVNGGNDYGSYNKSTNESTGMLREIMTGRADLAITDLTITS 510

Mouse   498 VREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSP 562
            .||:.:||:.|||:|||:|:..||||:.|.:|:|:||.:.|:|..:.|:::|||:..|::.|.||
  Fly   511 EREQALDFTIPFMNLGIAILYLKPQKATPELFTFMDPFSEEVWWFLGFSFLGVSLSFFILGRLSP 575

Mouse   563 YEWHS-----EEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFF 622
            .||.:     ||.||        ..|:|.:.||:||:.||.:|||.:|.|::||.|.|...||||
  Fly   576 SEWDNPYPCIEEPEE--------LENQFTLGNSIWFTTGALLQQGSEIGPKALSTRTVASFWWFF 632

Mouse   623 TLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTE-IAYGTLEAGSTKEFFRRSKIAVFEKMWT 686
            |||::||||||||||||:|:..|.|.|.:|||...: :.||..:.|||:.||..|....::||..
  Fly   633 TLIVVSSYTANLAAFLTIEKPQSLINSVDDLADNKDGVVYGAKKTGSTRNFFMTSAEERYKKMNK 697

Mouse   687 YMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATP 751
            :| |..|........||:.|| |:...||:|:|||..||..:|: |:..|:|..||.||||||..
  Fly   698 FM-SENPQYLTEDNMEGVNRV-KTNTHYAFLMESTSIEYNTKRE-CNLKKIGDALDEKGYGIAMR 759

Mouse   752 KGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGE--CGSKDSGSKDKTSALSLSNVAGVFYILI 814
            |....||..|.|:|:|.|||||:|:|:|||.:.|.  |.:|:. :.|.| .|.::|:.|||::|:
  Fly   760 KDWPHRGKFNNALLELQEQGVLEKMKNKWWNEVGTGICATKED-APDAT-PLDMNNLEGVFFVLL 822

Mouse   815 GGLGLAMLVALIEF 828
            .|...|:|..:|.:
  Fly   823 VGSCCALLYGIISW 836

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 99/397 (25%)
ANF_receptor 37..372 CDD:279440 87/369 (24%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 171/391 (44%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 126/287 (44%)
Glutamate binding. {ECO:0000250} 668..669 1/1 (100%)
PDZ-binding 904..907
GluRIIENP_001036733.1 PBP1_iGluR_Kainate 42..396 CDD:107377 93/377 (25%)
ANF_receptor 51..382 CDD:279440 83/354 (23%)
PBP2_iGluR_Kainate 419..790 CDD:270432 170/384 (44%)
Lig_chan 551..824 CDD:278489 125/286 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111018258
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.