DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir7c

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001245572.1 Gene:Ir7c FlyBaseID:FBgn0029966 Length:625 Species:Drosophila melanogaster

Alignment Length:462 Identity:93/463 (20%)
Similarity:177/463 (38%) Gaps:96/463 (21%)


Mouse   410 IVTTILEDPYVMLKKNANQFEGNDRY--EGYCVELAAEIAKHVGYSYRL---------EIVSDGK 463
            :|.|....|||:::.:.....|...:  ||.   :...:|:.:.::.:|         ||:.||.
  Fly   217 VVATFEHRPYVIIEDDPKTPGGRSIHGIEGL---IFRSLAERMNFTIKLVEQKDKNRGEILPDGN 278

Mouse   464 YGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGV 528
            :          .|::..:|.|..::.......:..|.:::..|..:.|..|.:::.......| :
  Fly   279 F----------TGILKMMVDGEVNLTFVCFMYSKARSDLMLPSTSYTSFPIVLVVPSGGSISP-M 332

Mouse   529 FSFLDPLAYEIWMCIVFAYI-GVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLW 592
            .....|..|.||.||:.:.| |..::..|.....|          |.......:.|... |..:|
  Fly   333 GRLTRPFRYIIWSCILVSLIFGFVLICLLKITALP----------GLRNLVLGRRNRLP-FMGMW 386

Mouse   593 FSL--GAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIES-AEDLA 654
            .||  |..:     .:|:....|.:..:|...|||:.::||..|...|....|.|||:| :|.||
  Fly   387 ASLLGGLAL-----YNPQRNFARYILVMWLLQTLILRAAYTGQLYLLLQDVEMRSPIKSLSEVLA 446

Mouse   655 KQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSV---FVRTTEEGMIRVR--KSKGKY 714
            |..|              ||     :...:.|..|.:.|:.   .|.:.||.:.|:|  ...|..
  Fly   447 KDYE--------------FR-----ILPALRTIFKDSMPTTNFHAVLSLEESLYRLRDEDDPGIT 492

Mouse   715 AYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATP-------------KGSALRGPVNLAVLK 766
            ..||:.|:|::..:..|           :|.:....|             ..|..:..::..::.
  Fly   493 VALLQPTVNQFDFRSGP-----------NKRHLTVLPDPLMTAPLTFYMRPHSYFKRRIDRLIMA 546

Mouse   767 LSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYK 831
            :...|::.:.: |.:.|:.:..||....:.|  .||:..::|:|....|...:|::|.::|....
  Fly   547 MMSSGIVARYR-KMYMDRIKRVSKRRNLEPK--PLSIWRLSGIFVCCAGLYLVALIVFILEILTT 608

Mouse   832 SRSESKR 838
            :....:|
  Fly   609 NHRRLRR 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385
ANF_receptor 37..372 CDD:279440
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 81/410 (20%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 65/301 (22%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir7cNP_001245572.1 Lig_chan-Glu_bd 225..287 CDD:214911 13/75 (17%)
Lig_chan 343..593 CDD:278489 65/299 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111187969
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.