DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir7b

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_572410.2 Gene:Ir7b FlyBaseID:FBgn0029965 Length:655 Species:Drosophila melanogaster

Alignment Length:479 Identity:86/480 (18%)
Similarity:172/480 (36%) Gaps:108/480 (23%)


Mouse   416 ED-PYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAW---NG 476
            || ||::.:.     :|:..:.|....|...:|:::.::.       |.|.....:..|.   :|
  Fly   218 EDMPYLVWRP-----DGSGSFVGIEGALLQFMAENLNFTV-------GLYWMNKEEVLATFDESG 270

Mouse   477 MVGELVYG-RADVAVAPLTITLVREEVIDFSKP---FMSLGISIMIKKPQKSKPGVFSFLD-PLA 536
            .:.:.::| .||.::............|.:|:.   |||   .||:....:|....:..|. |..
  Fly   271 RIFDEIFGHHADFSLGGFHFKPSAGSEIPYSQSTYYFMS---HIMLVTNLQSAYSAYEKLSFPFT 332

Mouse   537 YEIWMCIVFAYIGVSVVLFLVSRFSPYEW-HSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ 600
            ..:|..|....|...::|.|:.|     | |..|...          |.:  :..|..::|..::
  Fly   333 PLLWRAIGLVLILACLLLMLLVR-----WRHHHELPR----------NPY--YELLVLTMGGNLE 380

Mouse   601 QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLE 665
            ...  .|:....|:|...|.|.||::.|.|.:.:...|..:...:|.::..::..|    :.|::
  Fly   381 DRW--VPQRFPSRLVLLTWLFATLVLRSGYQSGMYQLLRQDTQRNPPQTISEVLAQ----HFTIQ 439

Mouse   666 AGSTKEFFRRSKIAVFE---KMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLESTMNEYIE 727
            .....|  .|...::.|   :...|::.:|...|....::        .|..|.:...|..||..
  Fly   440 LAEVNE--ARILASLPELRPEQLVYLEGSELQSFPALAQQ--------SGSSARVAILTPYEYFG 494

Mouse   728 QRKPCDTMK-----VGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWY----- 782
            ..:....|.     |...:.::.......:.|.|.|.:|..:......|.|:.     |.     
  Fly   495 YFRKVHPMSRRLHLVRERIYTQQLAFYVRRHSHLVGVLNKQIQHAHTHGFLEH-----WTRQYVS 554

Mouse   783 ---DKGECGSKDSGSKDKT------------------------SALSLSNVAGVFYILI-GGLGL 819
               :|.|..::.:.:...|                        :.||:..:|.:|:::: ..|| 
  Fly   555 AVDEKDESVARIASTSYSTLDGIDGDPSLSESEEDQQVAPVRQNVLSMRELAALFWLILWANLG- 618

Mouse   820 AMLVALIEFC---YKSRSESKRMK 840
            |::|.::|..   .|.|...::||
  Fly   619 AVVVFVLELLLPRIKLRKILRKMK 642

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385
ANF_receptor 37..372 CDD:279440
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 72/397 (18%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 52/321 (16%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir7bNP_572410.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111064825
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.