DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Nmdar2

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_001014714.1 Gene:Nmdar2 FlyBaseID:FBgn0053513 Length:1083 Species:Drosophila melanogaster

Alignment Length:924 Identity:208/925 (22%)
Similarity:355/925 (38%) Gaps:208/925 (22%)


Mouse    31 FPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEMTYRFCSQFSK-GVYAI--------F 86
            |....|.|.....|.:..||..|..:              ....|.:|.: .|.||        |
  Fly   138 FLKDYSFEQKNIHFDMMSLTPSPTAI--------------LSTLCKEFLRVNVSAILYMMNNEQF 188

Mouse    87 GFYERRTVNMLTSFCGALHVCFITPSFPVDTS--------NQFVLQLRPELQE---ALISIIDHY 140
            | :...:........|.|.:..|  |:..|.|        :...|||.|.::.   |::||::.|
  Fly   189 G-HSTASAQYFLQLAGYLGIPVI--SWNADNSGLERRASQSTLQLQLAPSIEHQSAAMLSILERY 250

Mouse   141 KWQTFVYIYDADRGL-SVLQRVLDTAAE--KNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVV 202
            ||..|..:.....|. ..:|.|.:..||  ::::.|.:|.:..|.....|   :|...:.|::::
  Fly   251 KWHQFSVVTSQIAGHDDFVQAVRERVAEMQEHFKFTILNSIVVTRTSDLM---ELVNSEARVMLL 312

Mouse   203 DCESERLNAILGQIVKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPARIM 267
            .........||....:::..|..|.::::.      .:.:.|::.:......|..:.||..|.:|
  Fly   313 YATQTEAITILRAAEEMKLTGENYVWVVSQ------SVIEKKDAHSQFPVGMLGVHFDTSSAALM 371

Mouse   268 QQWRTSDARDHTRVDWKRPKYTSALTYDGVKVMA---EAF--------QSLRRQRIDISRRGNAG 321
            .:  .|:|                     :|:.:   ||:        :.|..|.:.....|.. 
  Fly   372 NE--ISNA---------------------IKIYSYGVEAYLTDPANRDRRLTTQSLSCEDEGRG- 412

Mouse   322 DCLANPAVPWGQGIDIQRALQQVRFEGLTG--NVQFNEKGRRTNYTLHVIEMKHDGIRK------ 378
                    .|..|....:.|:.|..||...  |::|...|...:..|.::.::.....|      
  Fly   413 --------RWDNGEIFFKYLRNVSIEGDLNKPNIEFTADGDLRSAELKIMNLRPSANNKNLVWEE 469

Mouse   379 IGYWN--EDDKF------VPAATDAQAGGDNSSVQNRTYIVTTILED-PYVMLKK---------- 424
            ||.|.  |..|.      .|..:.|...|    |..:.::..|.||: ||:.|..          
  Fly   470 IGVWKSWETQKLDIRDIAWPG
NSHAPPQG----VPEKFHLKITFLEEAPYINLSPADPVSGKCLM 530

Mouse   425 ------------------NANQFEGNDRY----EGYCVELAAEIAKHVGYSYRLEIVSDGKYGAR 467
                              :..|...|:.:    .|:|::|..:.|:.:|::|.|..|.|||:|..
  Fly   531 DRGVLCRVAADHEMAADIDVGQAHRNESFYQCCSGFCIDLLEKFAEELGFTYELVRVEDGKWGTL 595

Mouse   468 DPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFS-- 530
              :...|||::.:||..:.|:.:..|.|...||.|:|||:|||..||:|::.|    :.|:.|  
  Fly   596 --ENGKWNGLIADLVNRKTDMVLTSLMINTEREAVVDFSEPFMETGIAIVVAK----RTGIISPT 654

Mouse   531 -FLDPLAYEIWMCI-VFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRD-----QTTSDQSNEFGIF 588
             ||:|.....||.: :.|....:.::||      :||.|   ..|.|     |.|:.....|.:|
  Fly   655 AFLEPFDTASWMLVGIVAIQAATFMIFL------FEWLS---PSGYDMKLYLQNTNVTPYRFSLF 710

Mouse   589 NSLWFSLGAFMQQGCDI-SPRSLSGRIVGGVWWFFTLIIISSYTANLAAF------------LTV 640
            .:.|.......|....: |||..:.|.:..||..|.::.::.||||||||            |..
  Fly   711 RTYWLVWAVLFQAAVHVDSPRGFTSRFMTNVWALFAVVFLAIYTANLAAFMITREEFHEFSGLND 775

Mouse   641 ERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMI 705
            .|:|.|      .:.:....:||:....|.....:    .|..|..||:....:    :..:|:.
  Fly   776 SRLVHP------FSHKPSFKFGTIPYSHTDSTIHK----YFNVMHNYMRQYNKT----SVADGVA 826

Mouse   706 RVRKSKGKYAYLLESTMNEY-IEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSE 769
            .|... ...:::.:.|:.:| :.|.:.|..|.||......|||:|..:.|......|..:|:...
  Fly   827 AVLNG-NLDSFIYDGTVLDYLVAQDEDCRLMTVGSWYAMTGYGLAFSRNSKYVQMFNKRLLEFRA 890

Mouse   770 QGVLDKLKSKWWYDKGEC--GSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIE---FC 829
            .|.|::|:..|.  .|.|  |.::..|.|   .|:|......|.:|:.|:.||.|:.|:|   |.
  Fly   891 NGDLERLRRYWM--TGTCRPGKQEHKSSD---PLALEQFLSAFLLLMAGILLAALLLLLEHVYFK 950

Mouse   830 YKSRSESKRMKGFC 843
            |..:..:|:..|.|
  Fly   951 YIRKRLAKKDGGHC 964

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385 76/408 (19%)
ANF_receptor 37..372 CDD:279440 68/371 (18%)
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 109/437 (25%)
Glutamate binding. {ECO:0000250} 492..494 1/2 (50%)
Lig_chan 538..817 CDD:278489 72/301 (24%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Nmdar2NP_001014714.1 PBP1_iGluR_NMDA_NR2 99..490 CDD:107373 77/410 (19%)
PBP2_iGluR_NMDA_Nr2 502..908 CDD:270436 110/438 (25%)
Lig_chan 665..928 CDD:278489 69/292 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C110922058
eggNOG 1 0.900 E1_KOG1052
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.