DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gria1 and Ir41a

Sequence 1:NP_001106796.1 Gene:Gria1 MGIID:95808 Length:907 Species:Mus musculus
Sequence 2:NP_995744.4 Gene:Ir41a FlyBaseID:FBgn0040849 Length:648 Species:Drosophila melanogaster

Alignment Length:471 Identity:96/472 (20%)
Similarity:172/472 (36%) Gaps:86/472 (18%)


Mouse   402 SSVQNRTYIVTTILEDPYVMLKKNAN---QFEG--------NDRYEGYCVELAAEIAKHVGYSYR 455
            :::|.|..|:......||.::|.|.:   |..|        |...:|....:.....:....:.:
  Fly   206 NNLQGREVIIAGFDYPPYTVIKHNMSTNAQDMGVSGESDFKNVYIDGTETRIVLNFCEQFNCTIQ 270

Mouse   456 LEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKK 520
            ::..:...:|...|:... :|.:|.|:..:||:.:..:.........:|.|...:..||:.::..
  Fly   271 IDSSAANDWGKVYPNMSG-DGALGMLINRKADICIGAMYSWYEDYTYLDLSMYLVRSGITCLVPA 334

Mouse   521 PQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEF 585
            |.:....... |:|....:|..|:......:..|.|..:.....:....:.||....||     |
  Fly   335 PLRLTSWYLP-LEPFKETLWAAILLCLCAEATGLVLAYKSEQALYVLPGYREGWWTCTS-----F 393

Mouse   586 GIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESA 650
            |:..:  |.|  |:.|..:....||:.|::....:...|||.|.|...||:.||:..|    :.|
  Fly   394 GVCTT--FKL--FISQSGNSKAYSLTVRVLLFACFLNDLIITSIYGGGLASILTIPSM----DEA 450

Mouse   651 EDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIR-VRKSKGKY 714
            .|..              |:..|.|.:.|...:.|.   ||     :|.::|.::: :..:...|
  Fly   451 ADTV--------------TRLRFHRLQWAANSEAWV---SA-----IRASDEALVKDILYNFHIY 493

Mouse   715 A--YLLESTMNEYIE-----QRKPCDTMKVGGNLDSKG--------------YGIA-TPKGSALR 757
            :  .||....::::.     :|.|.....:|..|..:.              |.:| .|:...|.
  Fly   494 SDDELLRLAQDQHMRIGFTVERLPFGHFAIGNYLGPQAIDQLVIMKDDIYFQYTVAFVPRLWPLL 558

Mouse   758 GPVNLAVLKLSEQG---------VLDKLKSKWWYDKGE--CGSKDSGSKDKTSALSLSNVAGVFY 811
            ..:|..:......|         |.|.|..|......|  .|:||.|    ...|.:||.||...
  Fly   559 DKLNTLIYSWHSSGFDKYWEYRVVADNLNLKIQQQVQETMTGTKDIG----PVPLGMSNFAGFII 619

Mouse   812 ILIGGLGLAMLVALIE 827
            :.|.|..:|.|..|:|
  Fly   620 VWILGSAIATLTFLLE 635

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gria1NP_001106796.1 PBP1_iGluR_AMPA_GluR1 26..389 CDD:107385
ANF_receptor 37..372 CDD:279440
PBP2_iGluR_AMPA_GluR1 406..787 CDD:270447 80/426 (19%)
Glutamate binding. {ECO:0000250} 492..494 0/2 (0%)
Lig_chan 538..817 CDD:278489 67/313 (21%)
Glutamate binding. {ECO:0000250} 668..669 0/1 (0%)
PDZ-binding 904..907
Ir41aNP_995744.4 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C111188096
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.