DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Grb7 and pico

Sequence 1:NP_034476.1 Gene:Grb7 MGIID:102683 Length:535 Species:Mus musculus
Sequence 2:NP_608363.1 Gene:pico FlyBaseID:FBgn0261811 Length:1162 Species:Drosophila melanogaster

Alignment Length:507 Identity:125/508 (25%)
Similarity:193/508 (38%) Gaps:120/508 (24%)


Mouse    34 PPPGDVKRSQPLPIPSSRKLREEEFQATSLPSIPNPFPELCS----------------------- 75
            ||||.:.....|.:.:.|:.|.|.      |...:.|.:..|                       
  Fly   244 PPPGGMTMGITLGVVTPREPRTES------PDNDSAFSDTVSLLSSESSASSNTSLQQQQQQQQQ 302

Mouse    76 ------------PPSQKPILGGS----------------SGARGLLPRDSSRLCV---------- 102
                        ...|||.|.|:                |||..:...|..:|.:          
  Fly   303 QHHQHQQHHQHQQQQQKPQLAGAEKLHHHGVHGQHGGQQSGANSITKADKIQLALHKLESAPIRR 367

Mouse   103 --VKVYSEDGACRSVEVAAGATARHVCEMLVQRAHALSDESWGLVESHPYLALERGLEDHEFVVE 165
              ||.::.|||.:|:.|.......||..:|..:.|.....:|.|||....|.:||..||||.:|:
  Fly   368 LFVKAFTSDGASKSLLVDERMGCGHVTRLLADKNHVQMQSNWALVEHLGDLQMERLFEDHELLVD 432

Mouse   166 VQEAWPVGGDSRFIFRKNFAKYELFKSPPHTLFPEKMVSSCL-DAQTGISHEDLIQNFLNAGSFP 229
            ....|.....:|.:|::...|..||..|...|...:|...|. |.||   .:.|:..|.::.:..
  Fly   433 NLMTWHSDAGNRVLFQQRPDKVTLFLRPELYLPGPQMAPGCQHDEQT---RQMLLDEFFDSHNQL 494

Mouse   230 EIQGFLQLRGSGRGSGRKLWKRFFCFLRRSGLYYSTKGTSKDPRHLQYVADVNESNVYVVTQGRK 294
            ::.|.|.:    :...:|.|||:...||.|||||..|..:|:.|.|..:...:..|||.....||
  Fly   495 QMDGPLYM----KADPKKGWKRYHFVLRSSGLYYFPKEKTKNTRDLACLNLFHGHNVYTGLGWRK 555

Mouse   295 LYGMPTD--FGF-CVKPNKLRNGHKGLHIFCSEDEQSRTCWLAAFRLFKYGVQLYKNYQQAQSRH 356
            .:..|||  ||| .|..:.|....:.|.:.|:||..:...||.|.|:.|||.||:.::       
  Fly   556 KWKSPTDYTFGFKAVGDSSLGKSCRSLKMLCAEDLPTLDRWLTAIRVCKYGKQLWDSH------- 613

Mouse   357 LRLSYLGSPPLRSVSDNTLVAMDFSGHAGRVIDNPREALSAAMEEAQAWRKKTNHRLS--LPTTC 419
                       :|:.::..::.|             :|:|.: ..|.:.|.::...:|  :|:.|
  Fly   614 -----------KSLLEDLCLSRD-------------DAVSQS-SFAASMRSESISSISSAVPSQC 653

Mouse   420 SGSSLSAAIHRTQPWFHGRISREESQRLIG----QQGLVDGVFLVRESQRNP 467
              .|:|:||........||.||..|....|    .....|..|.....:|.|
  Fly   654 --GSVSSAISSMSNSTSGRTSRASSSSSSGCLSDDNNAFDSEFTTGTIKRKP 703

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Grb7NP_034476.1 GRB7_RA 102..183 CDD:176382 26/93 (28%)
PH_APBB1IP 224..350 CDD:269961 43/129 (33%)
PH 229..341 CDD:278594 39/115 (34%)
BPS 369..413 CDD:286088 6/44 (14%)
SH2_Grb7 428..535 CDD:198276 11/45 (24%)
picoNP_608363.1 GRB7_RA 364..451 CDD:176382 26/87 (30%)
PH_APBB1IP 489..614 CDD:269961 43/147 (29%)
PH 494..605 CDD:278594 39/115 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C96358293
eggNOG 1 0.900 E1_KOG3751
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.833 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.