DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment UNC45B and Stip1

DIOPT Version :10

Sequence 1:NP_775259.1 Gene:UNC45B / 146862 HGNCID:14304 Length:931 Species:Homo sapiens
Sequence 2:NP_477354.1 Gene:Stip1 / 33202 FlyBaseID:FBgn0024352 Length:490 Species:Drosophila melanogaster


Alignment Length:187 Identity:49/187 - (26%)
Similarity:81/187 - (43%) Gaps:29/187 - (15%)


- Green bases have known domain annotations that are detailed below.


Human     5 EAVQLKEEGNRHFQLQDYKAATNSYSQALKLTKDKALLATLYRNRAACGLKTESYVQAASDASRA 69
            :|.:.||:||..|:..||..|...|::|:|...|.   ..||.|||||..|..::.....|....
  Fly   309 KAEEEKEQGNLFFKKGDYSTAVKHYTEAIKRNPDD---PKLYSNRAACYTKLAAFDLGLKDCDTC 370

Human    70 IDINSSDIKALYRRCQALEHLGKLDQAFKDVQRCATLEPRN----QNFQEMLRRLNTSIQEKLRV 130
            |.::...||...|:.:.|:.:.:..:|....|:...|:|.|    :.:::.......:.||.|:.
  Fly   371 IKLDEKFIKGYIRKGKILQGMQQQSKAQAAYQKALELDPNNAEAIEGYRQCSMNFQRNPQEVLKN 435

Human   131 QFSTDSRVQKMFEILLD-------ENSEADK---REKAANNLIVLGREEAGAEKIFQ 177
            ..| |..:|   :||.|       |..::|.   :|...|..|        |:||.:
  Fly   436 AMS-DPEIQ---QILKDPAMRMILEQMQSDPNAVKEHLQNPAI--------ADKIMK 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
UNC45BNP_775259.1 TPR repeat 39..72 CDD:276809 10/32 (31%)
TPR 2 43..76 10/32 (31%)
TPR 3 77..110 8/32 (25%)
TPR repeat 77..103 CDD:276809 6/25 (24%)
ARM 1 169..208 3/9 (33%)
armadillo repeat 172..208 CDD:293788 3/6 (50%)
ARM 2 211..250
armadillo repeat 214..245 CDD:293788
UNC45-central 344..489 CDD:432011
ARM 3 751..790
armadillo repeat 754..788 CDD:293788
3a0801s09 <6..>154 CDD:273380 42/158 (27%)
TPR 1 6..39 12/32 (38%)
TPR repeat 6..34 CDD:276809 11/27 (41%)
Stip1NP_477354.1 TPR repeat 7..32 CDD:276809
TPR 10..276 CDD:440225
TPR repeat 37..67 CDD:276809
TPR repeat 72..100 CDD:276809
LapB 173..415 CDD:442196 32/108 (30%)
TPR repeat 175..203 CDD:276809
TPR repeat 208..238 CDD:276809
TPR repeat 250..278 CDD:276809
TPR repeat 310..338 CDD:276809 11/27 (41%)
TPR repeat 343..373 CDD:276809 10/32 (31%)
TPR repeat 378..406 CDD:276809 6/27 (22%)
STI1 429..482 CDD:436075 17/64 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.