DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CSRP2 and Mlp84B

Sequence 1:NP_001287894.1 Gene:CSRP2 HGNCID:2470 Length:193 Species:Homo sapiens
Sequence 2:NP_001303418.1 Gene:Mlp84B FlyBaseID:FBgn0014863 Length:495 Species:Drosophila melanogaster

Alignment Length:191 Identity:92/192 (48%)
Similarity:116/192 (60%) Gaps:20/192 (10%)


Human     9 KCGACGRTVYHAEEVQCDGRSFHRCCFLCMVCRKNLDSTTVAIHDEEIYCKSCYGKKYGPKGYGY 73
            ||..||::||.|||....|..||:.||.|.:|.|:||||....|:.|:|||:|:|:|:||||||:
  Fly    11 KCPRCGKSVYAAEERLAGGYVFHKNCFKCGMCNKSLDSTNCTEHERELYCKTCHGRKFGPKGYGF 75

Human    74 GQGAGTLNMDRGERL----GIKPE-----SVQPHRPTTNPNTSKFAQKYGGAEKCSRCGDSVYAA 129
            |.|||||:||.|.:.    |..|.     .::|......|.          .|.|.|||..||||
  Fly    76 GTGAGTLSMDNGSQFLRENGDVPSVRNGARLEPRAIARAPE----------GEGCPRCGGYVYAA 130

Human   130 EKIIGAGKPWHKNCFRCAKCGKSLESTTLTE-KEGEIYCKGCYAKNFGPKGFGYGQGAGAL 189
            |:::..|:.|||.||:|..|.|.|:|....| .:..|||||||||.|||||:|||||.|||
  Fly   131 EQMLARGRSWHKECFKCGTCKKGLDSILCCEAPDKNIYCKGCYAKKFGPKGYGYGQGGGAL 191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CSRP2NP_001287894.1 LIM1_CRP2 9..63 CDD:188864 27/54 (50%)
Nuclear localization signal. {ECO:0000255} 64..69 3/5 (60%)
LIM2_CRP2 119..172 CDD:188871 28/54 (52%)
Mlp84BNP_001303418.1 LIM1_MLP84B_like 11..64 CDD:188788 27/53 (51%)
LIM_CRP_like 120..173 CDD:188712 27/53 (51%)
LIM_CRP_like 222..275 CDD:188712
LIM_CRP_like 325..378 CDD:188712
LIM_CRP_like 421..474 CDD:188712
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1700
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H111061
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1214165at2759
OrthoFinder 1 1.000 FOG0000884
OrthoInspector 1 1.000 T609080
orthoMCL 1 0.900 OOG5_128738
Panther 1 1.100 O PTHR24215
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.