DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gbx2 and unpg

Sequence 1:NP_034392.1 Gene:Gbx2 MGIID:95668 Length:348 Species:Mus musculus
Sequence 2:NP_477146.1 Gene:unpg FlyBaseID:FBgn0015561 Length:485 Species:Drosophila melanogaster

Alignment Length:429 Identity:147/430 (34%)
Similarity:184/430 (43%) Gaps:117/430 (27%)


Mouse     7 PSLMMMQRPLGSSTAFSIDSLI-------GSPPQP----------------------SPGHFVYT 42
            |:..:..:|.  ...|||:|||       .:||.|                      :......|
  Fly    18 PTTRLASKPF--PKPFSIESLIANQTPATATPPSPPEERDQEQEAEQEQELSARAMVASSALGLT 80

Mouse    43 GYPMFMPY---------------------------------RPVVLPPPPPPPPALPQAALQPAL 74
            .:|::.|:                                 :|.....|.||||..|..||:..|
  Fly    81 QFPLYNPWLHGYFAQNHERLTHLIAGGCYLPSSPAGHPAAQQPQAQAQPQPPPPHPPTHALEKQL 145

Mouse    75 PPAHPHHQIPSLPTGFC--SSLAQGMA---LTSTLMATLPG-------GFSASPQHQEAAAARKF 127
            ||..||    .|.|.|.  :..|.|:|   |:...:|.|..       ...|..||. |||.|..
  Fly   146 PPTLPH----PLDTRFLPFNPAAAGVAPTDLSYRRLAELMNQDYVHSLSVHARLQHM-AAAGRMH 205

Mouse   128 APQPLPGGGNFDKAEALQADAEDGKAFLAKEGSLLAFSAAEAVQASLVGAVRGQGKDESKVEDDP 192
            ..|..||.....:....||.:..     ||.||......|..|.........|....:..:...|
  Fly   206 EDQANPGMAQLQEPTPPQAHSSP-----AKSGSHSPMEPALDVGMDEDFECSGDSCSDISLTMSP 265

Mouse   193 --------KGKEESFSLESDVDYSSDDNLPGQTAHKEEDPGHALEETPQSGGAAG------STTS 243
                    |.:..:::.....|.|.|:.  .|:.|             :.||..|      .::|
  Fly   266 RNYNGEMDKSRNGAYTNSDSEDCSDDEG--AQSRH-------------EGGGMGGKDSQGNGSSS 315

Mouse   244 TGKNRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKIWFQNRRAKWKRVKAG 308
            ..|:||||||||||||||||:|||.|||||||||||||.:|||||||||||||||||||||||||
  Fly   316 NSKSRRRRTAFTSEQLLELEREFHAKKYLSLTERSQIATSLKLSEVQVKIWFQNRRAKWKRVKAG 380

Mouse   309 NANSKTGE--PSRNPKIVVPIPVHVSRFAIRSQHQQLEQ 345
            ..:...|.  .:...||||||||||:|||:||||||||:
  Fly   381 LTSHGLGRNGTTSGTKIVVPIPVHVNRFAVRSQHQQLEK 419

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gbx2NP_034392.1 Homeobox 250..304 CDD:333795 50/54 (93%)
unpgNP_477146.1 Homeobox 324..375 CDD:278475 47/51 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C260495482
eggNOG 1 0.900 E2759_KOG0489
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 176 1.000 Inparanoid score I4017
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002838
OrthoInspector 1 1.000 T615946
orthoMCL 1 0.900 OOG5_136883
Panther 1 1.100 O PTHR24334
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4817
TreeFam 1 0.960
109.870

Return to query results.
Submit another query.