DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG43774 and Anapc2

DIOPT Version :9

Sequence 1:	NP_608816.2	Gene:	CG43774 / 14462693	FlyBaseID:	FBgn0264296	Length:	95	Species:	Drosophila melanogaster
Sequence 2:	NP_780509.2	Gene:	Anapc2 / 99152	MGIID:	2139135	Length:	837	Species:	Mus musculus

Alignment Length:	46	Identity:	14/46 - (30%)
Similarity:	23/46 - (50%)	Gaps:	1/46 - (2%)

- Green bases have known domain annotations that are detailed below.

  Fly    49 SVPANQMAVPVQTTTTTVMPAQCATHWQEPQTMSALPPKYDQAVAA 94
            |.|..::.|...|.:|.::| ..|......:|..|:|||.::..||
Mouse    29 SRPGQELLVAWNTVSTGLVP-PAALGLASSRTSGAVPPKEEELRAA 73

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
CG43774	NP_608816.2	None
Anapc2	NP_780509.2	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	478..508
		CULLIN	524..657	CDD:214545
		APC2	772..832	CDD:198081
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	1	0.950	-	0	Normalized mean entropy	S3734
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.950