DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG43774 and APC2

DIOPT Version :9

Sequence 1:NP_608816.2 Gene:CG43774 / 14462693 FlyBaseID:FBgn0264296 Length:95 Species:Drosophila melanogaster
Sequence 2:NP_013228.1 Gene:APC2 / 850818 SGDID:S000004117 Length:853 Species:Saccharomyces cerevisiae


Alignment Length:49 Identity:12/49 - (24%)
Similarity:17/49 - (34%) Gaps:4/49 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NNVNNVNINVQCECYHRRGLLYY----ANPLAWGRPCRKCRRMMSRNNI 46
            ||:|.:....:.|.|:...|.|.    .|...|.......|..:...||
Yeast   123 NNINYLKDIQRWENYYEFPLRYVPIFDVNVNDWALELNSLRHYLLNRNI 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG43774NP_608816.2 None
APC2NP_013228.1 Cullin <628..732 CDD:395716
APC2 784..845 CDD:198081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3734
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.