powered by:
Protein Alignment CG43774 and APC2
DIOPT Version :9
Sequence 1: | NP_608816.2 |
Gene: | CG43774 / 14462693 |
FlyBaseID: | FBgn0264296 |
Length: | 95 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_013228.1 |
Gene: | APC2 / 850818 |
SGDID: | S000004117 |
Length: | 853 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 49 |
Identity: | 12/49 - (24%) |
Similarity: | 17/49 - (34%) |
Gaps: | 4/49 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 NNVNNVNINVQCECYHRRGLLYY----ANPLAWGRPCRKCRRMMSRNNI 46
||:|.:....:.|.|:...|.|. .|...|.......|..:...||
Yeast 123 NNINYLKDIQRWENYYEFPLRYVPIFDVNVNDWALELNSLRHYLLNRNI 171
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG43774 | NP_608816.2 |
None |
APC2 | NP_013228.1 |
Cullin |
<628..732 |
CDD:395716 |
|
APC2 |
784..845 |
CDD:198081 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S3734 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.950 |
|
Return to query results.
Submit another query.