DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rgk1 and rem2

Sequence 1:NP_725875.3 Gene:Rgk1 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_001116518.1 Gene:rem2 ZFINID:ZDB-GENE-081110-1 Length:306 Species:Danio rerio

Alignment Length:299 Identity:81/300 (27%)
Similarity:131/300 (44%) Gaps:58/300 (19%)


  Fly  1098 SVSARTSLASSRESSTSNPG----NGPYRVLMLGGPAVGKSSLV---------SQFMTSEYLHAY 1149
            |.:.:.|:.:.::|.:..|.    :||.|:::||...||||||.         |..:.||     
Zfish    48 SATPQISVTNIQDSPSLKPPQQKYHGPLRIVLLGQNGVGKSSLALCLAGLSDRSLSIDSE----- 107

  Fly  1150 DTSIDDESGEKAVSVLLSGEESELIFIDHGYTEMTPDECLTNYDPHGYCV-IYSAADRSSFSVAE 1213
             |...||...:.|:|  ..|:|.::..|:...|::..:|       ..|: ::|..||.||....
Zfish   108 -TQAADEGYPRRVTV--DDEDSSILVYDNWKQELSTLQC-------EVCILVFSLTDRRSFHRIA 162

  Fly  1214 QVLQVLWTNQNIAQKAVILVSNKADLARSRLVTSEEGKAMATAYDCKFIETSVGINHNVDELLVG 1278
            |:..:|  .:::....:|||.||:||.|||.:::||..:.|..:.|.::|.||.::|..::||..
Zfish   163 QLRLLL--RESLPHTPIILVGNKSDLVRSREISTEEAHSSAMMFGCLYLELSVSLDHRTNDLLEA 225

  Fly  1279 LLSQIRLKLENP---EKSRDLFRKRSIRKSKRRACSPLNAGCLNANTPLGPLGEAVATPPGSAQS 1340
            .:...|.....|   |.|....|:.|:....:|..|.|        .|...||......||..:.
Zfish   226 AVRAARGHSLGPGWTEGSPSAARRESLTSRAKRFLSGL--------VPRSHLGRERDREPGRDRD 282

  Fly  1341 SPRKYRGSRTSTSLKVKGLLGRVWTRDSKSKSCENLHVL 1379
            ..| :||||...               .||:||.:|..|
Zfish   283 LSR-HRGSRMLR---------------QKSRSCHDLSAL 305

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 74/271 (27%)
small_GTPase 1121..1286 CDD:197466 51/175 (29%)
rem2NP_001116518.1 P-loop_NTPase 75..305 CDD:304359 74/271 (27%)
Ras 76..231 CDD:278499 50/172 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45775
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
43.980

Return to query results.
Submit another query.