DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rgk1 and RRAD

Sequence 1:NP_725875.3 Gene:Rgk1 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_001122322.1 Gene:RRAD HGNCID:10446 Length:308 Species:Homo sapiens

Alignment Length:362 Identity:105/363 (29%)
Similarity:147/363 (40%) Gaps:98/363 (27%)


  Fly  1055 TGKGVVNRGDSLKSRRSRS----------NNSVASSNSSTEHLTTQQQLSAPASVSA----RTSL 1105
            :|.|....|...:.||..|          ..|:.......:...|...|:|.|:.:.    |...
Human     8 SGAGGSRGGGQERERRRGSTPWGPAPPLHRRSMPVDERDLQAALTPGALTAAAAGTGTQGPRLDW 72

  Fly  1106 ASSRESSTSNPGN----GPYRVLMLGGPAVGKSSLVSQFMTSE-------YLHAYDTSIDDESGE 1159
            ....|.|.|:.|:    ..|:||:||.|.||||:|...|...|       ..|.||.||      
Human    73 PEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSI------ 131

  Fly  1160 KAVSVLLSGEESELIFID---HGYTEMTPDECLTNYDPHGYCVIYSAADRSSFSVAEQVLQVLWT 1221
                 ::.|||:.|:..|   .......|..|:...|  .|.::||..|:.||..|.::...|..
Human   132 -----VVDGEEASLMVYDIWEQDGGRWLPGHCMAMGD--AYVIVYSVTDKGSFEKASELRVQLRR 189

  Fly  1222 NQNIAQKAVILVSNKADLARSRLVTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQIRLK 1286
            .:......:|||.||:||.|||.|:.:||:|.|..:||||||||..::|||..|..|::.||||:
Human   190 ARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIETSAALHHNVQALFEGVVRQIRLR 254

  Fly  1287 LENPEKSRDLFRKRSIRKSKRRACSPLNAGCLNANTPLGPLGEAVATPPGSAQSSPRKYRGSRTS 1351
                   ||                                         |.:::.|:..|:|..
Human   255 -------RD-----------------------------------------SKEANARRQAGTRRR 271

  Fly  1352 TSL--KVKGLLGRVWTRDS-------KSKSCENLHVL 1379
            .||  |.|..|||:..|:|       |||||.:|.||
Human   272 ESLGKKAKRFLGRIVARNSRKMAFRAKSKSCHDLSVL 308

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 88/277 (32%)
small_GTPase 1121..1286 CDD:197466 66/175 (38%)
RRADNP_001122322.1 RGK 92..308 CDD:206715 88/277 (32%)
RAS 92..252 CDD:214541 64/173 (37%)
Calmodulin-binding 278..297 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2445
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D301527at33208
OrthoFinder 1 1.000 FOG0003805
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45775
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5084
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.