DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rgk1 and Rrad

Sequence 1:NP_725875.3 Gene:Rgk1 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_062636.2 Gene:Rrad MGIID:1930943 Length:307 Species:Mus musculus

Alignment Length:384 Identity:112/385 (29%)
Similarity:156/385 (41%) Gaps:106/385 (28%)


  Fly  1015 GSRASGRPNQLCLPQQRSRVASMPNTGVEEEYYRLRHFSITGKGVVNRGDSLKSRRSRSNNSVAS 1079
            |||.:||        :|.|.......|.....:| |...:         |....:.:.:..|:|:
Mouse    11 GSRGAGR--------ERDRRRGSTPWGPAPPLHR-RSMPV---------DERDLQAALAPGSLAT 57

  Fly  1080 SNSSTEHLTTQQQLSAPASVSARTSLASSRESSTSNPGNGPYRVLMLGGPAVGKSSLVSQFMTSE 1144
            :.:.|.  |..|:|..|...|      .|..|..|....|.|:||:||.|.||||:|...|...|
Mouse    58 TAAGTR--TQGQRLDWPEGSS------DSLSSGGSGSEEGVYKVLLLGAPGVGKSALARIFGGIE 114

  Fly  1145 -------YLHAYDTSIDDESGEKAVSVLLSGEESELIFIDHGYTE---MTPDECLTNYDPHGYCV 1199
                   ..|.||.||           .:.|||:.|:..|....:   ..|..|:...|  .|.:
Mouse   115 DGPEAEAAGHTYDRSI-----------TVDGEEASLLVYDIWEQDGGCWLPGHCMAMGD--AYVI 166

  Fly  1200 IYSAADRSSFSVAEQVLQVLWTNQNIAQKAVILVSNKADLARSRLVTSEEGKAMATAYDCKFIET 1264
            :||..|:.||..|.::...|...:......:|||.||:||.|||.|:.:||:|.|..:|||||||
Mouse   167 VYSITDKGSFEKASELRVQLRRARQTDDVPIILVGNKSDLVRSREVSVDEGRACAVVFDCKFIET 231

  Fly  1265 SVGINHNVDELLVGLLSQIRLKLENPEKSRDLFRKRSIRKSKRRACSPLNAGCLNANTPLGPLGE 1329
            |..::|||..|..|::.||||:       ||                                  
Mouse   232 SAALHHNVQALFEGVVRQIRLR-------RD---------------------------------- 255

  Fly  1330 AVATPPGSAQSSPRKYRGSRTSTSL--KVKGLLGRVWTRDS-------KSKSCENLHVL 1379
                   |.:.:.|:..|:|...||  |.|..|||:..|:|       |||||.:|.||
Mouse   256 -------SKEDNARRQAGTRRRESLGKKAKRFLGRIVARNSRKMAFRAKSKSCHDLSVL 307

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 88/277 (32%)
small_GTPase 1121..1286 CDD:197466 66/175 (38%)
RradNP_062636.2 RGK 91..307 CDD:206715 88/277 (32%)
RAS 91..251 CDD:214541 64/173 (37%)
Calmodulin-binding. {ECO:0000250} 277..296 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S2445
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D301527at33208
OrthoFinder 1 1.000 FOG0003805
OrthoInspector 1 1.000 T130814
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR45775
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5084
TreeFam 1 0.960
87.960

Return to query results.
Submit another query.