DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rgk1 and rrad

Sequence 1:NP_725875.3 Gene:Rgk1 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_001016726.1 Gene:rrad XenbaseID:XB-GENE-491671 Length:303 Species:Xenopus tropicalis

Alignment Length:353 Identity:101/354 (29%)
Similarity:151/354 (43%) Gaps:85/354 (24%)


  Fly  1060 VNRGDSLKSRRSRSNN------------SVASSNSSTEHLTTQQQLSA----PA---SVSARTSL 1105
            :||.|..||...|..:            |:...:......|...|||:    |:   |...|.|.
 Frog     3 LNRSDRFKSLEKRRGSMPFSMHQQLHRRSMPVDDKELHGKTPASQLSSLVRCPSYNPSDEHRESW 67

  Fly  1106 ASSRESSTSNPGNGP----YRVLMLGGPAVGKSSLVSQFMTSEYLHAYDTSIDDESGEKAVSVLL 1166
            ||....|..:.|:..    |:|::||...||||||...|...|.||    .:::.......|:::
 Frog    68 ASDSSDSVISSGSDSEDHVYKVILLGEHGVGKSSLARIFGGVEDLH----DVEEAGNTYDRSIVV 128

  Fly  1167 SGEESELIFID---HGYTEMTPDECLTNYDPHGYCVIYSAADRSSFSVAEQVLQVLWTNQNIAQK 1228
            .|||:.|:..|   ........::|:...|  .|.::||..|::||..|.::...|...:.....
 Frog   129 DGEEACLLVFDIWEQDDNHWLHNQCMKMGD--AYVIVYSVTDKASFEKASELRIQLRRARQSEDI 191

  Fly  1229 AVILVSNKADLARSRLVTSEEGKAMATAYDCKFIETSVGINHNVDELLVGLLSQIRLKLENPEKS 1293
            .:|||.||:||.|||.|:.|||:|.|..:||||||||..::|||.:|..|::.||||:.::.|.:
 Frog   192 PIILVGNKSDLVRSREVSVEEGRACAVVFDCKFIETSASLHHNVKDLFEGIVRQIRLRKDSKEDN 256

  Fly  1294 RDLFRKRSIRKSKRRACSPLNAGCLNANTPLGPLGEAVATPPGSAQSSPRKYRGSRTSTSLKVKG 1358
                 .|.:..|||                                         |.|...|.|.
 Frog   257 -----ARRMASSKR-----------------------------------------RESIGKKAKR 275

  Fly  1359 LLGRVWTRDS-------KSKSCENLHVL 1379
            .||::..:::       |||||.:|.||
 Frog   276 FLGKIVAKNNKKMAFKQKSKSCHDLSVL 303

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 81/268 (30%)
small_GTPase 1121..1286 CDD:197466 63/168 (38%)
rradNP_001016726.1 RGK 87..303 CDD:206715 81/268 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D301527at33208
OrthoFinder 1 1.000 FOG0003805
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5084
TreeFam 1 0.960
54.910

Return to query results.
Submit another query.