DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rgk1 and Rgk2

Sequence 1:NP_725875.3 Gene:Rgk1 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_001286577.1 Gene:Rgk2 FlyBaseID:FBgn0085419 Length:742 Species:Drosophila melanogaster

Alignment Length:1012 Identity:267/1013 (26%)
Similarity:385/1013 (38%) Gaps:341/1013 (34%)


  Fly   421 GEPSST---TPLLSSQRRHPTGGHSPGSQRQEERRERKEREPSTAPPPTRIREHFTFDPPQSPKS 482
            |.|.|:   .|..::....|..|.:|...||..            ..||....:..:|.|:|||.
  Fly    19 GHPHSSHHKVPARAASNPLPCKGATPKLPRQYH------------GGPTSSYNYGGYDTPRSPKI 71

  Fly   483 ARSSEKSTSHFSFKNYGNESAKDAGVGSGKGTGSGAGVGGGGGSGSGVGGNGVMAASEGDEEDDE 547
            ..:            :..:|..|.                    .|....:.......|..:|  
  Fly    72 TTT------------FAQDSCDDV--------------------SSSTPSSYYQTPPSGSIDD-- 102

  Fly   548 RSGDSIGNRSKKLRPRERDPNHISPSVSPSHSRR-------------------ASPKRE-----K 588
             |...:..|:....|:.: ...:..:|||||.|:                   :||:|:     .
  Fly   103 -SASLLSGRTTARSPKSQ-CQFVFDAVSPSHGRKFEYYEPISPDDGALYYDPPSSPRRQGSKKLM 165

  Fly   589 RRTTPIASTGAISKVSSAPPTMKDANFFGSSG---------KQKQRQSQNIPPHQLSPSSQQRKY 644
            |..||:.....:: .:....:|..|...|.:|         .::||....:|......:......
  Fly   166 RTKTPLDPVPQLT-TTGVDESMAVAMAMGGAGGGGYAQGGPNKRQRDEWELPVISKIEARNLSAA 229

  Fly   645 SSSSSSGSSERCLREATGPGTMFPFDREALDYERIQRECFAPSSTTASNSSDSEAENCSVYERKS 709
            :.|||:|.|                      |..::|              ||...:|:....:|
  Fly   230 AGSSSAGGS----------------------YYGLKR--------------DSCVTDCTQLSMES 258

  Fly   710 GADIFQQYSRLSHQEQLQQHYQEPRDWERDRPPSRKNSKRIRPDSVIHTTIRENQQYVPQSDAFY 774
            |             |...||               .||     ..|.|||               
  Fly   259 G-------------ETGTQH---------------TNS-----TMVTHTT--------------- 275

  Fly   775 PQAKSSSSPSDHSYAELNKFEDIASKFEQIPPKHGSVSGSGSGSLLNLHHKMPSPGSESAVSPTD 839
                     :..|:.|        .:.||                                    
  Fly   276 ---------TSFSFTE--------PEMEQ------------------------------------ 287

  Fly   840 SARRRSFKNKQRHQKEEHFYIQTEDRSGTAAGNGPINVTANPLEAAAVCKQPRATIVVQQPSLSL 904
            .|.:...:.::||                     .||:|:||           ...|:.....:|
  Fly   288 EAGQPQLRRQRRH---------------------AINITSNP-----------GYQVLHSSHSTL 320

  Fly   905 DNT----VETLLIKNEGDFISVEQGKELVARKRNSQQLAHPPAHLHHHTQNHAHNHHTLQQQQHQ 965
            |.|    |.:|..:.....::.:...||...|.|.     |.||:.|..:....:...|.....:
  Fly   321 DRTCSDSVVSLRYRKSTSDLTQDAEHELSGCKPNK-----PKAHVEHKPRRRGSSKGGLAYLASR 380

  Fly   966 QQQQQQHKRDENMRQLLDVTNTLTIEELRDFQMRYGSPHHSRSQSVKMPGSRASGRPNQLCLP-- 1028
            :..:      |:|:......:.::.:::.  .:.:.|.:..|.:       |.|   |.|.||  
  Fly   381 RSSR------ESMKSACSNASIVSNDDVG--PLAFQSSNRGRQR-------RTS---NFLELPVP 427

  Fly  1029 -QQRSRVASMP----NTGVEEEYYRLRHFSITGKGVVNRGDSLKSRRSRSNNSVASSNSSTEHLT 1088
             ..|.||.|:|    |....::.||||||||:...|||.|||:.|||||||.||.|:||.....:
  Fly   428 DHVRPRVCSLPERPYNPRASDDLYRLRHFSISKGNVVNCGDSIISRRSRSNTSVNSTNSRASERS 492

  Fly  1089 TQQQLSAPASVSARTSLASSRESSTS--NPGNGPYRVLMLGGPAVGKSSLVSQFMTSEYLHAYDT 1151
            ..:.....|..:...||.::.:.|.:  .|....|||:|||...|||::||:|||||||:|.||.
  Fly   493 PFEGSCCGAGYANVDSLPATPDDSENLDPPPPARYRVVMLGDAGVGKTALVNQFMTSEYMHTYDA 557

  Fly  1152 S--IDDESGEKAVSVLLSGEESELIFIDHGYTEMTPDECLTNYDPHGYCVIYSAADRSSFSVAEQ 1214
            |  :|||.|||.|||||..|||:::||||...||:.:..|:.|:|||..|::|..|||||.|||:
  Fly   558 SLVLDDEFGEKTVSVLLDDEESDMVFIDHPSVEMSVENSLSTYEPHGCVVVFSVVDRSSFRVAEE 622

  Fly  1215 VLQVLWTNQNIAQKAVILVSNKADLARSRLVTSEEGKAMATAYDCKFIETSVGINHNVDELLVGL 1279
            ::..||.......||||||.|||||||:||:||:||||:|.:.|.||||||.||.|||||||||:
  Fly   623 IINYLWQENYTKDKAVILVGNKADLARARLITSQEGKALAASRDAKFIETSSGIQHNVDELLVGI 687

  Fly  1280 LSQIRLKLENPEKSRDLFRKRSIRKSKRRACSPLNAGCLNANTPLGPLGEAVATPPGSAQSSPRK 1344
            |.|:||| |..||                                              :::..|
  Fly   688 LKQMRLK-EKREK----------------------------------------------KATASK 705

  Fly  1345 YRGSRTSTSLKV-KGLLGRVWTRD-SKSKSCENLHVL 1379
            .:.|||..||.: |.||.::...| ||||||||||||
  Fly   706 MKTSRTHISLHLAKELLQKICLSDISKSKSCENLHVL 742

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079 46/289 (16%)
P-loop_NTPase 1121..1379 CDD:304359 128/262 (49%)
small_GTPase 1121..1286 CDD:197466 103/167 (62%)
Rgk2NP_001286577.1 RGK 527..742 CDD:206715 128/262 (49%)
small_GTPase 527..694 CDD:197466 103/167 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D301527at33208
OrthoFinder 1 1.000 FOG0003805
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR45775
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5084
44.140

Return to query results.
Submit another query.