DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rgk1 and gem

Sequence 1:NP_725875.3 Gene:Rgk1 FlyBaseID:FBgn0264753 Length:1379 Species:Drosophila melanogaster
Sequence 2:NP_001090822.1 Gene:gem XenbaseID:XB-GENE-483370 Length:299 Species:Xenopus tropicalis

Alignment Length:370 Identity:103/371 (28%)
Similarity:159/371 (43%) Gaps:90/371 (24%)


  Fly  1021 RPNQLCLPQQRSRVASMPNTGVEEEYYRLRHFSITGKGVVNRGDSLKSRRSRSNNSVASSNSSTE 1085
            |.|.....|||   .|:|.........:.:|.::|             |:..:||:  |.|:|.|
 Frog     9 RSNTTANVQQR---WSIPADAKNIHAQKKQHSNLT-------------RKYTANNT--SINNSAE 55

  Fly  1086 HLTTQQQLSAPASVSARTSLASSRESS--TSNPGNGPYRVLMLGGPAVGKSSLVSQFMTSEYLHA 1148
            :              .|.|.:|....|  :|..|:..|||:::|...||||:|.:.|.      .
 Frog    56 Y--------------CRRSWSSDSSDSVISSESGSTYYRVVLIGEQGVGKSTLANIFA------G 100

  Fly  1149 YDTSIDDESGEKAV-----SVLLSGEESELIFID----HGYTEMTPDECLTNYDPHGYCVIYSAA 1204
            ...|:|.:....|.     ::::.||.:.||.||    ........::|:...|  .|.::||..
 Frog   101 VPDSVDGDCDMLAENTYERNLMVDGESATLILIDMWENKAQDNWIREQCMQVGD--AYLIVYSIT 163

  Fly  1205 DRSSFSVAEQVLQVLWTNQNIAQKAVILVSNKADLARSRLVTSEEGKAMATAYDCKFIETSVGIN 1269
            ||:||..|.::...|...:......:|||.||:||.|.|.|:..||:|.|..:||||||||..:.
 Frog   164 DRASFEKASELRIQLRRARQTEDIPIILVGNKSDLVRCREVSVSEGRACAVVFDCKFIETSAAVQ 228

  Fly  1270 HNVDELLVGLLSQIRLKLENPEKSRDLFRKRSIRKSKRRACSPLNAGCLNANTPLGPLGEAVATP 1334
            |||.||..|::.|:||:.::.||:     :|.:...|||...|..|                   
 Frog   229 HNVKELFEGIVRQVRLRRDSKEKN-----ERRLAYQKRRESIPKKA------------------- 269

  Fly  1335 PGSAQSSPRKYRGSRTSTSLKVKGLLGRVWTRDSKSKSCENLHVL 1379
                    |::.|.  ..:.|.|.:..::     |||||.:|.||
 Frog   270 --------RRFWGK--IVAKKNKNMAFKL-----KSKSCHDLSVL 299

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rgk1NP_725875.3 DUF2967 459..715 CDD:288079
P-loop_NTPase 1121..1379 CDD:304359 80/267 (30%)
small_GTPase 1121..1286 CDD:197466 61/174 (35%)
gemNP_001090822.1 RGK 79..299 CDD:206715 80/267 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D301527at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.857 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.880

Return to query results.
Submit another query.