DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: pre-lola-G and lola

Sequence 1:NP_001260870.2 Gene:pre-lola-G FlyBaseID:FBgn0264817 Length:436 Species:Drosophila melanogaster
Sequence 2:NP_788308.3 Gene:lola FlyBaseID:FBgn0283521 Length:970 Species:Drosophila melanogaster

Alignment Length:471 Identity:128/472 (27%)
Similarity:163/472 (35%) Gaps:173/472 (37%)


  Fly   101 TASKNLNADEVMRVQNATATRVVGAAA----------GAAASFHPRPKYTLKTAASSTEHTTA-- 153
            ||:|......|.:.|...|..|.|.|.          .|||:.|..||.||.|..|:.....:  
  Fly   503 TAAKLEENQAVAQQQGQAAVTVTGPAGQPTPTITELLNAAAASHSEPKPTLTTLTSTPIKLPSSE 567

  Fly   154 ---------IPTSVLVA-----NSAAALTP------------------KPQAAVIAEALMRNGLH 186
                     ||.:..:|     .|:..:.|                  :.|...|.|....:..|
  Fly   568 CELINIKKIIPATTTIATHHPHTSSTIIHPHHIIQHVSQEPHHQEHHQQHQTIHIEEVPQTSQQH 632

  Fly   187 NFQQ---QLRAQEILRQQ-----TPH----------RRIKEENDVEIA-------GGDITPTKIL 226
            :.||   ||:..:....|     |.|          |.::..:...||       |..|.||  :
  Fly   633 HQQQHHHQLQTVQPTHTQVQSIITAHPGQTINLVGLRNVQLADSKPIASRIRYSRGKIIGPT--V 695

  Fly   227 ENLLRKQQERDLRHSECENEPGYSTEDDEEG---------------RYHAFDDIHL--------- 267
            :||...:....::|...|...|...|..|..               :|...|||.|         
  Fly   696 QNLQIVETHEPIQHQHHELSDGTKYEISEIDLNNPNASAAIISDLVKYAEIDDIELPDGTKIGIG 760

  Fly   268 ---------MEQSGGK-----------------------------------------FGNNSGMG 282
                     |:.|||:                                         ..::||..
  Fly   761 FAPSEITEHMQTSGGETHITTIEHEPQELQTVHQHEQTQQTHHIHAGQLQTHHIQTVVQSSSGQQ 825

  Fly   283 MFNANAHGGSASSILDAHQAFRNLEFTLSDYGGSSSNGSTT-------------SPNGIGL---- 330
            ..:...|....|..|........:  |..:.|...|:.|.|             .|:|:..    
  Fly   826 QHDQQQHHQHHSIELQDDDGVETI--TPEELGMHDSSKSYTILTTRPMKEESEHDPSGMTYELSL 888

  Fly   331 ---------DGEPVYECRHCGKKYRWKSTLRRHENVECGGKEPSHQCPYCPYKSKQRGNLGVHVR 386
                     |.|..|.|||||||||||||||||||||||||||.|.||||.||:|||||||||||
  Fly   889 SDSSLGPCDDPESRYVCRHCGKKYRWKSTLRRHENVECGGKEPCHPCPYCSYKAKQRGNLGVHVR 953

  Fly   387 KHHTDLPQLPSKRRSK 402
            |||.:.|||.|||..|
  Fly   954 KHHPEKPQLESKRGRK 969

Known Domains:


GeneSequenceDomainRegion External IDIdentity
pre-lola-GNP_001260870.2 C2H2 Zn finger 338..358 CDD:275368 20/20 (100%)
zf-H2C2_5 366..389 CDD:290620 20/23 (87%)
C2H2 Zn finger 368..388 CDD:275368 18/20 (90%)
lolaNP_788308.3 BTB 22..117 CDD:279045
BTB 33..117 CDD:197585
C2H2 Zn finger 905..925 CDD:275368 20/20 (100%)
C2H2 Zn finger 935..955 CDD:275368 18/20 (90%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C140903007
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.