DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and Prss44

DIOPT Version :9

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_683742.2 Gene:Prss44 / 73336 MGIID:1920586 Length:372 Species:Mus musculus


Alignment Length:243 Identity:76/243 - (31%)
Similarity:115/243 - (47%) Gaps:23/243 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 RVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNRVLTAAHCVNGQNASRISVVAGIR 110
            |:|||...|..:: |:|||:|.     ..:|.||||||:...|:||||||.|.  ...:|..|..
Mouse   111 RIVGGRPAPARKW-PWQVSLQV-----HKQHICGGSLISKWWVITAAHCVYGH--LDYAVFMGDA 167

  Fly   111 DLNDSSGFRSQVQSYEMNENYQEL--VTSDIAILKIDPPFELDEKRVSTIDVSGSDMVGADQEVL 173
            ||......|..||...:::::..:  |..|||::.:..|...............|.:|.......
Mouse   168 DLWSKRPVRIPVQDIIVHQDFSMMRTVVHDIALVLLAFPVNYSVNIQPVCIPEKSFLVQPGTLCW 232

  Fly   174 LTGWGSVFHFGTGPFAKYPTVLQKLDYKTLSNSKCKETM--------TQLTDTEICALERFGKGA 230
            :||||.|...|     :...:||:::...:.:.||.:.:        |.:.:..:|.....|..|
Mouse   233 VTGWGKVLEQG-----RSSRILQEIELNIIRHEKCNQILKDIMGNIFTLVQEGGVCGYNEKGGDA 292

  Fly   231 CNGDSGGPLVMKSGESYKQVGVVSYGTAFCASNNPDVYTRVSMFDGWI 278
            |.||||||||.:..:::.|||:||:|........|.|||.||.:..||
Mouse   293 CQGDSGGPLVCEFNKTWVQVGIVSWGLGCGRIGYPGVYTEVSYYRDWI 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 74/241 (31%)
Tryp_SPc 47..280 CDD:238113 75/242 (31%)
Prss44NP_683742.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 31..72
Tryp_SPc 111..340 CDD:214473 74/241 (31%)
Tryp_SPc 112..340 CDD:238113 73/240 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.