DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12256 and CG8586

DIOPT Version :8

Sequence 1:NP_650166.2 Gene:CG12256 / 14462452 FlyBaseID:FBgn0038002 Length:283 Species:Drosophila melanogaster
Sequence 2:NP_001286204.1 Gene:CG8586 / 35854 FlyBaseID:FBgn0033320 Length:444 Species:Drosophila melanogaster

Alignment Length:293 Identity:75/294 (26%)
Similarity:122/294 (41%) Gaps:66/294 (22%)


  Fly    23 SKPMGNVIDLDKYFEEADLNSQERVVGGYDVPEDEYVPYQVSMQFLTRSGKMRHFCGGSLIAPNR 87
            |.|.|.:.|.||:....|::    :.|.:        |:.|.:    .:|:....|||:||.|..
  Fly   175 SNPKGLIPDNDKFPYSEDVS----IFGEF--------PWMVGI----FTGRQEFLCGGTLIHPRL 223

  Fly    88 VLTAAHCVNGQNASRISVVAGIRDLNDSSGFRSQVQSYEMNENY-------QELVT--------- 136
            |:|.:|.:..:....:...||..|||            .:||.|       :|::.         
  Fly   224 VVTTSHNLVNETVDTLVARAGDWDLN------------SLNEPYPHQGSRIKEIIMHSEFDPNSL 276

  Fly   137 -SDIAILKIDPPFELDEKRVSTIDVSGSDMVGADQEVL-----LTGWGSVFHFGTGPFAKYPTVL 195
             :|||:|.:|.|..| ...:..:.:...:......::|     .||||:. ..|:.   |...||
  Fly   277 YNDIALLLLDEPIRL-APHIQPLCLPPPESPELTNQLLSVTCYATGWGTK-EAGSD---KLEHVL 336

  Fly   196 QKLDYKTLSNSKCK--------ETMTQLTDTEICALERFGKGACNGDSGGPLVMK-SGE--SYKQ 249
            ::::...:...:|:        |...:|..:.|||....||..|.||.|.||..: .||  .|:.
  Fly   337 KRINLPLVEREECQAKLRNTRLEARFRLRPSFICAGGDPGKDTCKGDGGSPLFCQMPGEMDRYQL 401

  Fly   250 VGVVSYGTAFCASNNPDVYTRVSMFDGWIKERM 282
            ||:||:|......:.|.||..|....|||.|::
  Fly   402 VGIVSWGVECAVEDIPAVYVNVPHLRGWIDEKI 434

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG12256NP_650166.2 Tryp_SPc 46..278 CDD:214473 66/265 (25%)
Tryp_SPc 47..280 CDD:238113 67/266 (25%)
CG8586NP_001286204.1 Tryp_SPc 197..433 CDD:238113 68/265 (26%)
Tryp_SPc 197..430 CDD:214473 66/262 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24256
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.